Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2140 bp · TkA01G112920|TK1151|cDNA
GTAAGAAATAAAGAGTTTCCATCTATTTGTTCATTTTTAATTGTAAAAAGTAATGTTTAAGAAGTTACTTCTGAATTCTGATTATAGGTTTTTGACATAATAATCTATCAGCCTTCCTTTTTTTTTTCTTCCCGCTGGACGTTGCCTCCATCATCGACGCTTGCTACCATCAACAACGACAACCACCACCACCACCGGCGCTGTTACCCACCACCGCCACCGGCGCTGCTACCCACCAACGTGGCTACTGCATCGAGCAC...
1293 bp · TkA01G112920|TK1151|CDS
ATGAAGTCCATAACTAACGATTTGCATTTACTCTCATTACTTCATAAAATCTTCACCTCCCATCTCCCTCACCACCATCAACAACTCCGAGCAATCACAAAAGTCCGATTAAAATGGGTCAAAAACCGATCCTTAGACAGCGTCATCGACTTACACACCGATCTAAAAGCCGCCTGTTTACTCAAAGACGCGATCATCAACCGCCCTCCCGCCGCCCAATTCCTCACCGCCAAATCCATCTCCGACACCCAAAAACTCCT...
Protein
Download Protein FASTA430 aa · TkA01G112920|TK1151|PROTEIN
MKSITNDLHLLSLLHKIFTSHLPHHHQQLRAITKVRLKWVKNRSLDSVIDLHTDLKAACLLKDAIINRPPAAQFLTAKSISDTQKLLGITIPTLRFIRRYPTLFEEFPHPKYRSLPCFRLTNIATNLHKIETQIYKSHESNTVEKLCKLLMMTKDKQIPLQSLHPLRWDLGFPYDYDKTLIQNHPDKFQIVKGPNGLSSLKLVKWIDEFAVSELQKSNEIKDDDSYRRFTRTGSSLTFPLSFPRGYGAQKKVKSWMDEFQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G112920 |
|---|---|
| TK1151 ID | TkA01G112920 |
| OH-1004 ID | LXL04_027401 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 36.000 |
| Protein coverage (%) | TK1151 82.558 / OH-1004 82.326Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G112920 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:28668505-28670793 (-) | |||||||||
| Description | Similar to WTF9: Protein WHAT'S THIS FACTOR 9, mitochondrial | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000373 Group II intron splicing Biological Process GO:0006397 mRNA processing Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0008380 RNA splicing Biological Process GO:0010102 lateral root morphogenesis Biological Process GO:0015979 photosynthesis Biological Process GO:0017004 cytochrome complex assembly Biological Process GO:0005576 extracellular region Cellular Component GO:0005739 mitochondrion Cellular Component GO:0009507 chloroplast Cellular Component GO:0003723 RNA binding Molecular Function GO:0003729 mRNA binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G39120 ath:AT4G01037 ath:AT4G33495 dosa:Os05g0571100 osa:4339664 zma:100277394 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF11955PORR40-372 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G112920 | PF11955 | PORR | 40 | 372 | 2.8e-114 | 382.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.