TkA01G109690 | RubberDandelionOmics

Gene overview

TkA01G109690

Reference: TK1151 Chr: Chr01 Coordinates: 27868872-27870716 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

777 bp · TkA01G109690|TK1151|cDNA

TATACGGTGAAGGTATTTAATATGCCCTTTTGGGCCTACGAGGGAGCATTTTTGTGCATTTTTATTCCCACTCACCTGTTTCCCCATTCTTCCTCCACCTCTCCTTCTCTCCATCGCATTTTTCCTTCGATCAAATCGATTTCATTCATATAACAGCATAGCGTAAAGGATCCTTCATCGCATACTCAATCCATGGCGCTTGGCTCAGGAGGATCGAGTGTCGTGGTGCCTCGAAATTTCAGATTGCTGGAGGAGCTTGA...

CDS

Download CDS FASTA

441 bp · TkA01G109690|TK1151|CDS

ATGGCGCTTGGCTCAGGAGGATCGAGTGTCGTGGTGCCTCGAAATTTCAGATTGCTGGAGGAGCTTGAGCGTGGAGAAAAGGGTATCGGAGATGGCACTGTGAGCTATGGAATGGATGATGGTGATGATATCTATATGCGATCATGGACAGGCACCATCATCGGCCCTCACAATTCTGTGCATGAGGGTCGCATCTACCAATTGAAGCTATTTTGTGACAAAGATTACCCTGAGAAGCCTCCAACTGTCCGTTTCCATTC...

Protein

Download Protein FASTA

146 aa · TkA01G109690|TK1151|PROTEIN

MALGSGGSSVVVPRNFRLLEELERGEKGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNSVHEGRIYQLKLFCDKDYPEKPPTVRFHSRVNMTCVNHETGVVEPKKFGILGNWQREYTMEDILIRLKKEMASPHNRKLVQPPEGTCF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G109690`
TK1151 ID	TkA01G109690
OH-1004 ID	LXL04_004805
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G109690

Location Chr01:27868872-27870716 (-)

Description Similar to UEV1D: Ubiquitin-conjugating enzyme E2 variant 1D

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52560`	Has no ubiquitin ligase activity on its own.	Arabidopsis UEV1D promotes Lysine-63-linked polyubiquitination and is involved in DNA damage response.2008 · DOI: 10.1105/tpc.107.051862
`At2g36060`	Has no ubiquitin ligase activity on its own.	No verified direct reference in this release
`At1g23260`	Has no ubiquitin ligase activity on its own.	No verified direct reference in this release
`At1g70660`	Has no ubiquitin ligase activity on its own.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004805 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006301 DNA damage tolerance Biological Process

GO:0006974 DNA damage response Biological Process

GO:0070534 protein K63-linked ubiquitination Biological Process

GO:1902916 positive regulation of protein polyubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0031371 ubiquitin conjugating enzyme complex Cellular Component

GO:0031372 UBC13-MMS2 complex Cellular Component

KEGG gene cross-reference

ath:AT1G23260

ath:AT1G70660

ath:AT2G36060

ath:AT3G52560

ddi:DDB_G0292596

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.756

Rank 1 · TkA01G109690 · TK1151

Cytoplasm0.291

Rank 2 · TkA01G109690 · TK1151

Cell membrane0.092

Rank 3 · TkA01G109690 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA01G109690 · TK1151

Mitochondrion0.026

Rank 5 · TkA01G109690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179UQ_con44-136 aa

PF05773RWD66-89 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G109690	`PF00179`	UQ_con	44	136	2.2e-14	54.0
TkA01G109690	`PF05773`	RWD	66	89	0.29	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVD7`	Arabidopsis thaliana	sp\|Q9SVD7\|UEV1D_ARATH Ubiquitin-conjugating enzyme E2 variant 1D	92.500%	Swiss-Prot	High
`Q9SJ44`	Arabidopsis thaliana	sp\|Q9SJ44\|UEV1C_ARATH Ubiquitin-conjugating enzyme E2 variant 1C	89.700%	Swiss-Prot	High
`Q93YP0`	Arabidopsis thaliana	sp\|Q93YP0\|UEV1A_ARATH Ubiquitin-conjugating enzyme E2 variant 1A	75.200%	Swiss-Prot	High
`Q9CAB6`	Arabidopsis thaliana	sp\|Q9CAB6\|UEV1B_ARATH Ubiquitin-conjugating enzyme E2 variant 1B	74.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card