TkA01G101250 | RubberDandelionOmics

Gene overview

TkA01G101250

Reference: TK1151 Chr: Chr01 Coordinates: 25619708-25625609 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2982 bp · TkA01G101250|TK1151|cDNA

ATGACGATCGCGATCGAGGAGAACGTGGCCGGAAAATGGGGAAAAGCAGAGAAAGTGACCAGTAAGAATGGCGGAGATAGTTCTGGGTCAGGTGTTTCTGGGTTTCAATTCACGCCTCCCTCTGCGTCGGTGCCTCCTACACCAACTCCGGTGACTCCGGCTCCAACTGGTGCTGTGATTCCTCCGAGTGGTGTTCCTTCATCAGGGGGTTTTCCATGGTCCGTGAAGAAGTTGCCGGAATCTCAAGCGCTGGGATATTT...

CDS

Download CDS FASTA

2982 bp · TkA01G101250|TK1151|CDS

ATGACGATCGCGATCGAGGAGAACGTGGCCGGAAAATGGGGAAAAGCAGAGAAAGTGACCAGTAAGAATGGCGGAGATAGTTCTGGGTCAGGTGTTTCTGGGTTTCAATTCACGCCTCCCTCTGCGTCGGTGCCTCCTACACCAACTCCGGTGACTCCGGCTCCAACTGGTGCTGTGATTCCTCCGAGTGGTGTTCCTTCATCAGGGGGTTTTCCATGGTCCGTGAAGAAGTTGCCGGAATCTCAAGCGCTGGGATATTT...

Protein

Download Protein FASTA

993 aa · TkA01G101250|TK1151|PROTEIN

MTIAIEENVAGKWGKAEKVTSKNGGDSSGSGVSGFQFTPPSASVPPTPTPVTPAPTGAVIPPSGVPSSGGFPWSVKKLPESQALGYFIAGLGDDVKKWVRLHRPKSRLDAMYLAKDVEEMLRPSLHVGSQTRFRYQPSGGSGMGCNLDFRPSSMTRPEFKGGGFSKPNLSRADTGRPVFPPKPVSTNPPETFTPRNRGTRSLSRTEWEDRRKKGLCFRCSQQFGPAHKCPEGKLRILLLGDDEEEGDNMVLQGTDDILTP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G101250`
TK1151 ID	TkA01G101250
OH-1004 ID	LXL04_013040
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	48.900
Protein coverage (%)	TK1151 96.173 / OH-1004 71.222 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G101250

Location Chr01:25619708-25625609 (+)

Description Similar to TY3B-G: Transposon Ty3-G Gag-Pol polyprotein (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`AtMg00860`	Uncharacterized mitochondrial protein AtMg00860.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013040 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0075523 viral translational frameshifting Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0003887 DNA-directed DNA polymerase activity Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

KEGG gene cross-reference

sce:YGR109W-B

sce:YIL082W-A

spo:2538755

spo:2541833

spo:2541991

spo:3361422

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.460

Rank 1 · TkA01G101250 · TK1151

Nucleus0.334

Rank 2 · TkA01G101250 · TK1151

Mitochondrion0.172

Rank 3 · TkA01G101250 · TK1151

Peroxisome0.070

Rank 4 · TkA01G101250 · TK1151

Plastid0.046

Rank 5 · TkA01G101250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078RVT_1291-357 aa

PF00078RVT_1367-405 aa

PF24626SH3_Tf2-1831-879 aa

PF31073DUF8803849-875 aa

PF22938Integrase_p58_C860-878 aa

PF00385Chromo903-934 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G101250	`PF00078`	RVT_1	291	357	4.6e-15	56.8
TkA01G101250	`PF00078`	RVT_1	367	405	4.6e-15	56.8
TkA01G101250	`PF24626`	SH3_Tf2-1	831	879	1.1e-13	51.7
TkA01G101250	`PF31073`	DUF8803	849	875	0.25	11.9
TkA01G101250	`PF22938`	Integrase_p58_C	860	878	0.087	13.6
TkA01G101250	`PF00385`	Chromo	903	934	0.0022	18.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92523`	Arabidopsis thaliana	sp\|P92523\|M860_ARATH Uncharacterized mitochondrial protein AtMg00860	48.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card