TkA01G101240 | RubberDandelionOmics

Gene overview

TkA01G101240

Reference: TK1151 Chr: Chr01 Coordinates: 25614512-25617061 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1770 bp · TkA01G101240|TK1151|cDNA

CCGCAATATAGCGGCTAATTAAAATAAAACGTTAAGGTGCACGTTGTGACAACTCGATTCTACGGGGTTGTTGGGGTACAAAGGTCATAGTCGTGGGACCAATCACGTTGCTCCGTTTTGCCACGCTGGCACACCATCACAATATTCACCTGCTTTTCCCCATTTTCCGGCCACGTTCTCCTCGATCGCGATCGTCATGTATTCCGATTTTGCCCTTGCGGTTCGCAATTCCATCCTTCATGTCTTAAAATAAAGAAAAC...

CDS

Download CDS FASTA

702 bp · TkA01G101240|TK1151|CDS

ATGAAACCGCAAATCAAAACGGGTCGGCCAGTTAAAGACGACGACGGCGCCAGTTCAACCGCTTCACCACTCGCCACCACTCCTGGTGGCCGACGACGGAACAGCACCTCCGGCTTTTCTTTCCGGCTAGACGAACGAGCCCAAAGAAGAAAAGAGTTTTTTTCAAAGGTTGAAGAGAAGGTTCAGGCAAAAGAAGTAGAAAAAACCACTTTGCAAGCCAAATCAAAGGAAAGCCAGGATGAGGAGATTAAGAAATTGAG...

Protein

Download Protein FASTA

233 aa · TkA01G101240|TK1151|PROTEIN

MKPQIKTGRPVKDDDGASSTASPLATTPGGRRRNSTSGFSFRLDERAQRRKEFFSKVEEKVQAKEVEKTTLQAKSKESQDEEIKKLRKSLTFKASPMPKFYKEPPPKTELKKTPTTRPISPKLGRSKSSLSTVSKSSEQMATSGSPRAGRGGQTASSRLNPMNRDKNTGASKKTNTKSKTEIKTGKSKEKGLEDERVEDSEVAAVNRRDVESWLEDSVAKDTAPAEDVVGLGG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G101240`
TK1151 ID	TkA01G101240
OH-1004 ID	LXL04_012949
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	52.000
Protein coverage (%)	TK1151 81.545 / OH-1004 50.552 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G101240

Location Chr01:25614512-25617061 (-)

Description Similar to WDL4: Protein WVD2-like 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35880`	Microtubule-associated protein (MAP) that regulates the orientation of interphase cortical microtubules.	No verified direct reference in this release
`At4g32330`	Microtubule-associated protein (MAP) that regulates the orientation of interphase cortical microtubules.	No verified direct reference in this release
`At2g25480`	Microtubule-associated protein (MAP) that regulates the orientation of interphase cortical microtubules.	No verified direct reference in this release
`At3g23090`	Microtubule-associated protein (MAP) that regulates the orientation of interphase cortical microtubules.	Light-regulated hypocotyl elongation involves proteasome-dependent degradation of the microtubule regulatory protein WDL3 in Arabidopsis.2013 · DOI: 10.1105/tpc.113.112789
`At5g28646`	Microtubule-associated protein (MAP) that regulates the orientation of interphase cortical microtubules.	WVD2 and WDL1 modulate helical organ growth and anisotropic cell expansion in Arabidopsis.2003 · DOI: 10.1104/pp.015966 WVD2 is a novel microtubule-associated protein in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2006.03015.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012949 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0001578 microtubule bundle formation Biological Process

GO:0007163 establishment or maintenance of cell polarity Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010091 trichome branching Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0051511 negative regulation of unidimensional cell growth Biological Process

GO:0071369 cellular response to ethylene stimulus Biological Process

GO:0072657 protein localization to membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT2G25480

ath:AT2G35880

ath:AT3G23090

ath:AT4G32330

ath:AT5G28646

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.714

Rank 1 · TkA01G101240 · TK1151

Nucleus0.283

Rank 2 · TkA01G101240 · TK1151

Cell membrane0.173

Rank 3 · TkA01G101240 · TK1151

Endoplasmic reticulum0.039

Rank 4 · TkA01G101240 · TK1151

Golgi apparatus0.026

Rank 5 · TkA01G101240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06886TPX239-113 aa

PF06886TPX2182-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G101240	`PF06886`	TPX2	39	113	3.4e-24	85.3
TkA01G101240	`PF06886`	TPX2	182	183	3.4e-24	85.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJ62`	Arabidopsis thaliana	sp\|Q9SJ62\|WDL4_ARATH Protein WVD2-like 4	77.400%	Swiss-Prot	Low
`Q94C48`	Arabidopsis thaliana	sp\|Q94C48\|WDL5_ARATH Protein WVD2-like 5	57.900%	Swiss-Prot	Low
`Q0WSZ8`	Arabidopsis thaliana	sp\|Q0WSZ8\|WDL6_ARATH Protein WVD2-like 6	48.600%	Swiss-Prot	Medium
`Q84WL6`	Arabidopsis thaliana	sp\|Q84WL6\|WDL3_ARATH Protein WVD2-like 3	60.400%	Swiss-Prot	Low
`Q84ZT9`	Arabidopsis thaliana	sp\|Q84ZT9\|WVD2_ARATH Protein WAVE-DAMPENED 2	50.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card