TkA01G101230 | RubberDandelionOmics

Gene overview

TkA01G101230

Reference: TK1151 Chr: Chr01 Coordinates: 25611711-25614279 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2095 bp · TkA01G101230|TK1151|cDNA

GCAACCGCTATAACATGTTATTTGTTCACGGGCCTTTGTCTCCTCCACTCCTTTTCCCATACGAAACGACACCATATCTCGTCGTTTCATTCCTCACTCATTTTTTCCATTTATTCCGATTCCGGCATAACCAAAACCTGGAGAGAGAAACAACTCCAGAATCCCCAAAACACATTTGATAATCTCCAAAAAGAGAAAGATAGATTAAACCCAATTTCCCCCAATCTCAAAACTGTCTTCAATCTTGATATTTTCACAGT...

CDS

Download CDS FASTA

1425 bp · TkA01G101230|TK1151|CDS

ATGGATTCTCAGATCTATGGTGCATTGGGGATCTTCTTTTCCATATTTTATCTCATACCACCTGCAGCCATTAATGCAGCTGAGTTACCGCAACAATACACCAAATCTAGTTCTGGTTCCACCCAGATCAACTCCAACTCTGTTCTTGTTGCGCTTCTGGATTCGCACTACACTGAGCTGTCGGAGCTCGTTGAGAAAGCGCTGCTTCTACAGACACTTGAGGAAGCGGTTTCTCGTCACAATATCACCATTTTTGCGCC...

Protein

Download Protein FASTA

474 aa · TkA01G101230|TK1151|PROTEIN

MDSQIYGALGIFFSIFYLIPPAAINAAELPQQYTKSSSGSTQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPSNEALERYLDPEFKRFLLEPGNLKSLQNLLLFHIIPSRVGSKEWPEENLASVTYETLCVEEAENHLPLTREESGEKIVAGLAKVIRPDDVIRPDGLIHGIERLLVPRLVQEEFNRRRSLSSISAVLPEGAPVVDPRTHRLKKPATPAPAGAPPALPVYDAMAPGPSLAPAPAP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G101230`
TK1151 ID	TkA01G101230
OH-1004 ID	LXL04_004852
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G101230

Location Chr01:25611711-25614279 (+)

Description Similar to FLA17: Fasciclin-like arabinogalactan protein 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06390`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At3g11700`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At2g35860`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At3g52370`	May be a cell surface adhesion protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004852 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT2G35860

ath:AT3G11700

ath:AT3G52370

ath:AT5G06390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.231

Rank 1 · TkA01G101230 · TK1151

Extracellular0.203

Rank 2 · TkA01G101230 · TK1151

Endoplasmic reticulum0.131

Rank 3 · TkA01G101230 · TK1151

Lysosome / Vacuole0.120

Rank 4 · TkA01G101230 · TK1151

Plastid0.119

Rank 5 · TkA01G101230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02469Fasciclin56-193 aa

PF02469Fasciclin307-420 aa

PF06821Ser_hydrolase351-404 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G101230	`PF02469`	Fasciclin	56	193	1.5e-30	106.7
TkA01G101230	`PF02469`	Fasciclin	307	420	1.5e-30	106.7
TkA01G101230	`PF06821`	Ser_hydrolase	351	404	0.11	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q66GR0`	Arabidopsis thaliana	sp\|Q66GR0\|FLA17_ARATH Fasciclin-like arabinogalactan protein 17	72.200%	Swiss-Prot	High
`Q93W32`	Arabidopsis thaliana	sp\|Q93W32\|FLA18_ARATH Fasciclin-like arabinogalactan protein 18	70.900%	Swiss-Prot	High
`Q8RWC5`	Arabidopsis thaliana	sp\|Q8RWC5\|FLA16_ARATH Fasciclin-like arabinogalactan protein 16	72.600%	Swiss-Prot	High
`Q9FT45`	Arabidopsis thaliana	sp\|Q9FT45\|FLA15_ARATH Fasciclin-like arabinogalactan protein 15	69.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card