TkA01G100490 | RubberDandelionOmics

Gene overview

TkA01G100490

Reference: TK1151 Chr: Chr01 Coordinates: 25413939-25415927 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1712 bp · TkA01G100490|TK1151|cDNA

CGACACCATTGCATGCAGTCAATGTGACCCATTTTTTGCATTAATGCTTATACCTACGGTGGCCGTTACTGTTACCTCCCGAAATTCAGTTCGCCGGTTGCTTTCTACTCAATGGCACGTTCCTTTTTCTTACTATACTCACTCTCCCGCCGGCGAGTCTCCGACTCACTCAGAAGCTTGTTCTTCATACCCACCGCCTTAGCTCTCACCACATCTCTCTTCATTCTGTTCTACATTTCATCAACCTCTACTCTCTTCAC...

CDS

Download CDS FASTA

1398 bp · TkA01G100490|TK1151|CDS

ATGGCACGTTCCTTTTTCTTACTATACTCACTCTCCCGCCGGCGAGTCTCCGACTCACTCAGAAGCTTGTTCTTCATACCCACCGCCTTAGCTCTCACCACATCTCTCTTCATTCTGTTCTACATTTCATCAACCTCTACTCTCTTCACCTCTCAACAACATCGCAATTCTCGTCTTCATTTCCTACAAAAACCTAATGGAGTTTCTCATAAAAGTCACAATTTGCAAACCGCAATCGGAAATCAACCCCAATCCAGTCC...

Protein

Download Protein FASTA

465 aa · TkA01G100490|TK1151|PROTEIN

MARSFFLLYSLSRRRVSDSLRSLFFIPTALALTTSLFILFYISSTSTLFTSQQHRNSRLHFLQKPNGVSHKSHNLQTAIGNQPQSSPDFDSPIPNLGPTADPGGAAKPSPSSNGRTVEDETVFHDVEIFKEDYIKMNMSFKIFVYPHQRSDPFANVLLPVDFEPEGNYASESFFKKSLNNSHFITKDPSIADLFYLPFSIARLRHDPRVGIDGIQDFIKEYVYNISHKYPYWNRTGGADHFYVSCHSIGRIAINKADEVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G100490`
TK1151 ID	TkA01G100490
OH-1004 ID	LXL04_004875
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G100490

Location Chr01:25413939-25415927 (-)

Description Similar to At5g03795: Probable glycosyltransferase At5g03795

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03795`	May be involved in cell wall biosynthesis.	No verified direct reference in this release
`UniProt: Q9LFP3`	May be involved in cell wall biosynthesis.	No verified direct reference in this release
`At3g07620`	May be involved in cell wall biosynthesis.	No verified direct reference in this release
`At5g20260`	May be involved in cell wall biosynthesis.	No verified direct reference in this release
`At3g42180`	May be involved in cell wall biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004875 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G03795

ath:AT5G11130

ath:AT5G20260

ath:AT5G25310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.780

Rank 1 · TkA01G100490 · TK1151

Endoplasmic reticulum0.080

Rank 2 · TkA01G100490 · TK1151

Cell membrane0.055

Rank 3 · TkA01G100490 · TK1151

Cytoplasm0.039

Rank 4 · TkA01G100490 · TK1151

Extracellular0.035

Rank 5 · TkA01G100490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03016Exostosin_GT47138-413 aa

PF24785RXYLT1_C335-379 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G100490	`PF03016`	Exostosin_GT47	138	413	2.8e-66	224.6
TkA01G100490	`PF24785`	RXYLT1_C	335	379	0.12	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFN2`	Arabidopsis thaliana	sp\|Q9FFN2\|GLYT3_ARATH Probable glycosyltransferase At5g03795	36.300%	Swiss-Prot	Medium
`Q9LFP3`	Arabidopsis thaliana	sp\|Q9LFP3\|GLYT4_ARATH Probable glycosyltransferase At5g11130	34.100%	Swiss-Prot	Medium
`Q9SSE8`	Arabidopsis thaliana	sp\|Q9SSE8\|GLYT1_ARATH Probable glycosyltransferase At3g07620	33.300%	Swiss-Prot	Medium
`Q3E9A4`	Arabidopsis thaliana	sp\|Q3E9A4\|GLYT5_ARATH Probable glycosyltransferase At5g20260	33.200%	Swiss-Prot	Medium
`Q3EAR7`	Arabidopsis thaliana	sp\|Q3EAR7\|GLYT2_ARATH Probable glycosyltransferase At3g42180	30.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card