TkA01G096300 | RubberDandelionOmics

Gene overview

TkA01G096300

Reference: TK1151 Chr: Chr01 Coordinates: 24330395-24336186 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1037 bp · TkA01G096300|TK1151|cDNA

TTGCCTTCTTTCTCATTTCGGCCGCGACAGATTTTTTCCTCCCAAGGGCGATTTCCGGCGAGAAGAAGGACCTGTTCTCCGGCGTCTTCCGGCCAACCTTCAGACTTGTTCTCCGGCGTGTTCCGTCCCGCCTGCGACTCCTCCGTTCTGCTAGCCATTGTCCGACGCTTAACCATTGTCCGACGCTTAGCCATTGTCCGACGCGAAGGTGCCATCTCCCTCTGTCGACGTCCCACTCGAACCAGGCTCCCCTCGAAGGT...

CDS

Download CDS FASTA

660 bp · TkA01G096300|TK1151|CDS

ATGACCAATGAGGAACCAGCGTATCAAAGATCCTACTTCGACCATGCACTTATGAATGAAATTCCAAGTGAATTTCAAGCATACGTGTCACACATACAAAATGTGGATGGAGATGGACACTGTGGATTTCGGGCAGTACCGGTTGCTCTTGGCTTTAGTGAAAACTATTGGAGTCAAATTCGGACAGACTTATATGGAGAGTTATTAATGCACATTGATGATTACAGAGTGGTTTTTCAAGAGGACATAAGCAGCATTAG...

Protein

Download Protein FASTA

219 aa · TkA01G096300|TK1151|PROTEIN

MTNEEPAYQRSYFDHALMNEIPSEFQAYVSHIQNVDGDGHCGFRAVPVALGFSENYWSQIRTDLYGELLMHIDDYRVVFQEDISSISEALNYYGTPAIRKYWMIMPDTGILIANKYGVIVHFLSKDGSSTCFPLWSGPQDFANHPIINIALTNRCHYVNVDLQEGHPLANVSWLWNMHKSAHSIGWQTLYQARLNAYVPPYRPTNRHTTTYNISDQTAS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G096300`
TK1151 ID	TkA01G096300
OH-1004 ID	LXL04_011038
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.900
Protein coverage (%)	TK1151 75.342 / OH-1004 22.029 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G096300

Location Chr01:24330395-24336186 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37310`	Pentatricopeptide repeat-containing protein At2g37310.	No verified direct reference in this release
`At3g47530`	Pentatricopeptide repeat-containing protein At3g47530.	No verified direct reference in this release
`At5g48910`	Pentatricopeptide repeat-containing protein At5g48910.	No verified direct reference in this release
`At5g13230`	Putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial.	No verified direct reference in this release
`At3g18970`	Pentatricopeptide repeat-containing protein At3g18970.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011038 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.790

Rank 1 · TkA01G096300 · TK1151

Cytoplasm0.455

Rank 2 · TkA01G096300 · TK1151

Cell membrane0.022

Rank 3 · TkA01G096300 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA01G096300 · TK1151

Mitochondrion0.018

Rank 5 · TkA01G096300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10275Peptidase_C6518-49 aa

PF29258OTU_Vertnin35-77 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G096300	`PF10275`	Peptidase_C65	18	49	0.067	13.4
TkA01G096300	`PF29258`	OTU_Vertnin	35	77	0.04	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUT5`	Arabidopsis thaliana	sp\|Q9ZUT5\|PP191_ARATH Pentatricopeptide repeat-containing protein At2g37310	42.200%	Swiss-Prot	Medium
`Q9SN85`	Arabidopsis thaliana	sp\|Q9SN85\|PP267_ARATH Pentatricopeptide repeat-containing protein At3g47530	34.500%	Swiss-Prot	Medium
`Q9FI80`	Arabidopsis thaliana	sp\|Q9FI80\|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910	29.600%	Swiss-Prot	Low
`Q9LYV3`	Arabidopsis thaliana	sp\|Q9LYV3\|PP377_ARATH Putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial	27.600%	Swiss-Prot	Low
`Q9LJ69`	Arabidopsis thaliana	sp\|Q9LJ69\|PP243_ARATH Pentatricopeptide repeat-containing protein At3g18970	32.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card