Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2387 bp · TkA01G088380|TK1151|cDNA
GGGGGGGGGTCTGGTTAGGATGTTCGACATAGAAGGTATGGTGGCCGTTTCAGCCACGGACGGTAGTCAGACCGACAGAACTTTCGCCGGAAGAGGAGACGAGATTATACATTCCACTTCAACGACTGCCGAATCGCTAACCAAAGTAGGCGATACGTTTGTTTAATTAGTAGAAGGGTTTTCGTTTTCTTCCAAAATTGATGGAATAAAATCACATCAAGTAATGGAATCAACATTGTGATTGAAGCATGCGTGTTAAA...
1593 bp · TkA01G088380|TK1151|CDS
ATGGAAGGGTATTCATTTGAAGAGCAAAATCAAAGGGACATTGTGACAAAGTCACCAAATTCAGTTCCAAATTCCCCAAAAAACCCTGCAGATTCTTTGCATAAACTAAAAGGGAAGATAAACAAAAGGTCAACAAGATCTGGAGCTGAATGTTCCTCCTCCTCACAGACCAAGAACAACAAAAAGCTAACATTCAAGGATCAACAAATGAACCGGTTGGTATTCCAAGAAGGAGGATTACCCGATGGATCCGAAGTATT...
Protein
Download Protein FASTA530 aa · TkA01G088380|TK1151|PROTEIN
MEGYSFEEQNQRDIVTKSPNSVPNSPKNPADSLHKLKGKINKRSTRSGAECSSSSQTKNNKKLTFKDQQMNRLVFQEGGLPDGSEVFYISHGMRVLKGYKWGRGIFCCCCNTTISPSQFEAHAGQASRKKPYDNIYISNGVSLHEYASLLKLKNGHMSKKNDDLCGVCKEGGELWLCHGCPRSFHKGCVFERSETSTSEGKWFCKYCRNSMKCLLQNSGEQIAKRNIRIVYNPEKCHLVACAICRAYDFSTVGFNDRTVL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G088380 |
|---|---|
| TK1151 ID | TkA01G088380 |
| OH-1004 ID | LXL04_005084 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.800 |
| Protein coverage (%) | TK1151 97.170 / OH-1004 90.813Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G088380 |
|---|---|
| Location | Chr01:22499709-22506596 (-) |
| Description | Similar to IDM1: Increased DNA methylation 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006366 transcription by RNA polymerase II Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0010629 negative regulation of gene expression Biological Process GO:0015671 oxygen transport Biological Process GO:0035092 sperm DNA condensation Biological Process GO:0042659 regulation of cell fate specification Biological Process GO:0045595 regulation of cell differentiation Biological Process |
| KEGG gene cross-reference | ath:AT3G14980 hsa:1108 mmu:107932 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16135TDBD101-146 aaPF00628PHD107-111 aaPF15063TC1113-137 aaPF16744zf-RING_15160-209 aaPF23011PHD-1st_NSD160-208 aaPF00628PHD165-207 aaPF23004PHDvar_NSD165-192 aaPF22908PHD_NSD165-204 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G088380 | PF16135 | TDBD | 101 | 146 | 1.9e-14 | 54.1 |
| TkA01G088380 | PF00628 | PHD | 107 | 111 | 9.9e-09 | 35.8 |
| TkA01G088380 | PF15063 | TC1 | 113 | 137 | 0.02 | 15.7 |
| TkA01G088380 | PF16744 | zf-RING_15 | 160 | 209 | 0.00045 | 21.1 |
| TkA01G088380 | PF23011 | PHD-1st_NSD | 160 | 208 | 0.02 | 15.7 |
| TkA01G088380 | PF00628 | PHD | 165 | 207 | 9.9e-09 | 35.8 |
| TkA01G088380 | PF23004 | PHDvar_NSD | 165 | 192 | 0.49 | 11.1 |
| TkA01G088380 | PF22908 | PHD_NSD | 165 | 204 | 3.5 | 8.7 |
| TkA01G088380 | PF15063 | TC1 | 200 | 244 | 0.02 | 15.7 |
| TkA01G088380 | PF22908 | PHD_NSD | 240 | 283 | 3.5 | 8.7 |
| TkA01G088380 | PF00628 | PHD | 241 | 293 | 9.9e-09 | 35.8 |
| TkA01G088380 | PF23004 | PHDvar_NSD | 255 | 280 | 0.49 | 11.1 |
| TkA01G088380 | PF16744 | zf-RING_15 | 257 | 277 | 0.00045 | 21.1 |
| TkA01G088380 | PF23011 | PHD-1st_NSD | 259 | 293 | 0.02 | 15.7 |
| TkA01G088380 | PF23209 | IDM1_C | 371 | 510 | 3.1e-44 | 151.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.