TkA01G078010 | RubberDandelionOmics

Gene overview

TkA01G078010

Reference: TK1151 Chr: Chr01 Coordinates: 19927364-19931007 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2985 bp · TkA01G078010|TK1151|cDNA

GGGGGCTAAAAGAAAATGTTTCACCCTCGGGAAAACAAGCTTTTTGAATGGGGACGGCCATGATTCATATGAACACGAATACCAACTCAGGGCCCGATAGATTCTTTCCAATTAATCAAAGAACAAAAACAAATCACCCTACCATGGATTAAGAACTCTGTTTACTGATCAAAGCCAACTAAGCTACACGCCTGAAAGTTTCTAAATTATAGTATCTCTCAGTGACCCAGTCCTTCAAGCTTGATCGGGAACACGTTGTT...

CDS

Download CDS FASTA

2400 bp · TkA01G078010|TK1151|CDS

ATGAGCTCTTCGTCATCGAATTCAAGTAATGAATTTTTGAGTTTCAACGAAAAAAATCCCGTTGTGGGGTTTAGTTCGCCGGGGTTGACGGCGTCAAGGAATCCCGGTGCGGCTACTACTTCAGCTTCGACTCTTTCACGGCCACGGCTTCTGAAGGTGAGAAAACACACTTCTCATAACCAGAAGTTAACTAATCCCATGGACAACCGGGTTTCAGAGGCTGATCCAGGTTTAGGGTTTAACCAATTTAGAAGCTCATC...

Protein

Download Protein FASTA

799 aa · TkA01G078010|TK1151|PROTEIN

MSSSSSNSSNEFLSFNEKNPVVGFSSPGLTASRNPGAATTSASTLSRPRLLKVRKHTSHNQKLTNPMDNRVSEADPGLGFNQFRSSSKVVLGNLSFENDPNETFLFGAKRDNNSDVIIDDISELKIDCDKDYADPTQNNALKIDDSSNLTSVKNSQGTDSTNKSQFTDFVKSEKMAEFAFTSRLDDIGTPQVEFRTPDMKSNLFSGLNRFEAKKESAKDIISKKKKEKSKKPILGQSKLHEDYGFTRSNLSENPNAFPYD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G078010`
TK1151 ID	TkA01G078010
OH-1004 ID	LXL04_005175
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G078010`
Location	Chr01:19927364-19931007 (-)
Description	Similar to DNAJC7: DnaJ homolog subfamily C member 7
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005175` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:1900034 regulation of cellular response to heat Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005856 cytoskeleton Cellular Component GO:0016020 membrane Cellular Component GO:0070062 extracellular exosome Cellular Component GO:0001671 ATPase activator activity Molecular Function GO:0031072 heat shock protein binding Molecular Function
KEGG gene cross-reference	hsa:7266 mmu:56354 pon:100173101 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.576

Rank 1 · TkA01G078010 · TK1151

Nucleus0.360

Rank 2 · TkA01G078010 · TK1151

Cell membrane0.083

Rank 3 · TkA01G078010 · TK1151

Golgi apparatus0.062

Rank 4 · TkA01G078010 · TK1151

Endoplasmic reticulum0.056

Rank 5 · TkA01G078010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10036RLL238-238 aa

PF29407CFAP70_TPR_C305-408 aa

PF25575TPR_BSK1_C306-387 aa

PF07719TPR_2311-337 aa

PF00515TPR_1313-336 aa

PF13428TPR_14313-336 aa

PF10952DUF2753315-344 aa

PF13414TPR_11317-345 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G078010	`PF10036`	RLL	238	238	0.058	14.0
TkA01G078010	`PF29407`	CFAP70_TPR_C	305	408	0.00018	21.8
TkA01G078010	`PF25575`	TPR_BSK1_C	306	387	1e-08	35.8
TkA01G078010	`PF07719`	TPR_2	311	337	5.3e-19	67.4
TkA01G078010	`PF00515`	TPR_1	313	336	1.3e-19	69.8
TkA01G078010	`PF13428`	TPR_14	313	336	2e-05	25.5
TkA01G078010	`PF10952`	DUF2753	315	344	0.00093	20.1
TkA01G078010	`PF13414`	TPR_11	317	345	4e-05	23.9
TkA01G078010	`PF12895`	ANAPC3	335	374	0.0074	17.3
TkA01G078010	`PF30484`	ETO1_C	350	388	0.00011	22.2
TkA01G078010	`PF13374`	TPR_10	355	381	0.31	11.8
TkA01G078010	`PF07719`	TPR_2	356	386	5.3e-19	67.4
TkA01G078010	`PF13424`	TPR_12	356	373	0.00021	22.1
TkA01G078010	`PF13181`	TPR_8	359	386	4.4e-08	33.4
TkA01G078010	`PF13414`	TPR_11	365	387	4e-05	23.9
TkA01G078010	`PF25060`	ARM_TT21_2nd	365	411	0.045	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card