TkA01G077440 | RubberDandelionOmics

Gene overview

TkA01G077440

Reference: TK1151 Chr: Chr01 Coordinates: 19770473-19773678 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

690 bp · TkA01G077440|TK1151|cDNA

TCAGTACACCATTAATGGCGGCCATGCATGAAGACCACACCCCAAACTTGACAGAAGTCGCCAAGATTCTAGAAGAAACCCTAAATATAAAGGACGTGCCATTGAAAGTAAGAAAACTGGTGGTGAAAATATGTGACGTGGTGACAAGAAGGGCAGCCAGGCTGGCGGCTGCAGGAATTGTTGGAATTTTGAAAAAGATTGGAAGGGACGGAACTGCCGGAATTACAAGTGGGAGGGTGAAAAGTGGAAAATCTGGAAAA...

CDS

Download CDS FASTA

1530 bp · TkA01G077440|TK1151|CDS

ATGGGGAAGGTAGGATTATGTTTGGCTGTGGGGTGTGCTTTGGCGAGTTGTGCGATCGCGGCAGTGATGGTGGGGAGGAGAGTAAAGAGTCGACGACGATGGTGGAACGTCGTTAGGGCCTTGGATGAGTTTGAAGAGGCGGCGTCGACACCAGTCGGAAGGTTAAGACAAGTGGTTGATGCTATGGCCGTTGAGATGCACGCTGGTTTGGCTTCCGAGGGTGGGAGTAAGCTTAAGATGTTACTCACCTATGTCGACAA...

Protein

Download Protein FASTA

509 aa · TkA01G077440|TK1151|PROTEIN

MGKVGLCLAVGCALASCAIAAVMVGRRVKSRRRWWNVVRALDEFEEAASTPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDNLPDGSENGTYYALHIGGTNFRLLRIQLGGQRSILGHDVERKPIPQHLMTSTSEELFDFITVSLKEFIETTNGANQIRGKDLGFTFSFPVKQTSLSSGTLIKWTKGFSIDDMVEKDVVECLQKALCRTGLDMNVAALVNDSVGTLALGHFYDKDTVAAVVIGTGTNACYLERAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G077440`
TK1151 ID	TkA01G077440
OH-1004 ID	LXL04_005183
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G077440

Location Chr01:19770473-19773678 (-)

Description Similar to At1g50460: Hexokinase-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50460`	Fructose and glucose phosphorylating enzyme (By similarity).	Function of Arabidopsis hexokinase-like1 as a negative regulator of plant growth.2009 · DOI: 10.1093/jxb/erp252 Arabidopsis Hexokinase-Like1 and Hexokinase1 form a critical node in mediating plant glucose and ethylene responses.2012 · DOI: 10.1104/pp.112.195636
`At3g20040`	Fructose and glucose phosphorylating enzyme (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0940100`	Fructose and glucose phosphorylating enzyme.	OsHXK3 encodes a hexokinase-like protein that positively regulates grain size in rice.2022 · DOI: 10.1007/s00122-022-04189-7
`Os05g0375100`	Fructose and glucose phosphorylating enzyme.	Structure, expression, and functional analysis of the hexokinase gene family in rice (Oryza sativa L.).2006 · DOI: 10.1007/s00425-006-0251-y
`Os05g0187100`	Fructose and glucose phosphorylating enzyme.	Structure, expression, and functional analysis of the hexokinase gene family in rice (Oryza sativa L.).2006 · DOI: 10.1007/s00425-006-0251-y

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005183 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001678 intracellular glucose homeostasis Biological Process

GO:0006006 glucose metabolic process Biological Process

GO:0006096 glycolytic process Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009747 hexokinase-dependent signaling Biological Process

GO:0009749 response to glucose Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0012501 programmed cell death Biological Process

GO:0019318 hexose metabolic process Biological Process

GO:0051156 glucose 6-phosphate metabolic process Biological Process

KEGG gene cross-reference

ath:AT1G50460

ath:AT2G19860

ath:AT3G20040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.408

Rank 1 · TkA01G077440 · TK1151

Mitochondrion0.221

Rank 2 · TkA01G077440 · TK1151

Peroxisome0.214

Rank 3 · TkA01G077440 · TK1151

Nucleus0.151

Rank 4 · TkA01G077440 · TK1151

Endoplasmic reticulum0.079

Rank 5 · TkA01G077440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00349Hexokinase_141-234 aa

PF11603Sir1131-163 aa

PF03727Hexokinase_2243-493 aa

PF00349Hexokinase_1368-390 aa

PF00349Hexokinase_1444-462 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G077440	`PF00349`	Hexokinase_1	41	234	6.1e-68	229.3
TkA01G077440	`PF11603`	Sir1	131	163	0.01	17.0
TkA01G077440	`PF03727`	Hexokinase_2	243	493	3.3e-75	253.3
TkA01G077440	`PF00349`	Hexokinase_1	368	390	6.1e-68	229.3
TkA01G077440	`PF00349`	Hexokinase_1	444	462	6.1e-68	229.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPS1`	Arabidopsis thaliana	sp\|Q9LPS1\|HXK3_ARATH Hexokinase-3	68.600%	Swiss-Prot	High
`Q56XE8`	Arabidopsis thaliana	sp\|Q56XE8\|HXK4_ARATH Hexokinase-4	65.500%	Swiss-Prot	High
`Q2KNB4`	Oryza sativa subsp. japonica	sp\|Q2KNB4\|HXK3_ORYSJ Hexokinase-3	65.000%	Swiss-Prot	High
`Q2KNB5`	Oryza sativa subsp. japonica	sp\|Q2KNB5\|HXK10_ORYSJ Hexokinase-10	58.000%	Swiss-Prot	High
`Q1WM16`	Oryza sativa subsp. japonica	sp\|Q1WM16\|HXK7_ORYSJ Hexokinase-7	48.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card