TkA01G077380 | RubberDandelionOmics

Gene overview

TkA01G077380

Reference: TK1151 Chr: Chr01 Coordinates: 19746740-19747854 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

766 bp · TkA01G077380|TK1151|cDNA

AAAAGGAGAACGCCGCTCACAAACATCGTCTGTGTAATTGTGTTAAAAGGTAGCGGAAGCCGGCGGCGATGCGGAGTAAGCCAAACATACTAGTGACCGGTACACCGGGAACTGGGAAGACTACCACGTCGGCGGCGCTGGCGGAGGCAACTAATCTTCGCCACATCAACATAGGAGACCTTGTTAGGGATAAGAAGTTGCACGATGGTTGGGACGACGAACTCGAATGCTACGTCATCAATGAAGATCTGGTTTGTGAC...

CDS

Download CDS FASTA

510 bp · TkA01G077380|TK1151|CDS

ATGCGGAGTAAGCCAAACATACTAGTGACCGGTACACCGGGAACTGGGAAGACTACCACGTCGGCGGCGCTGGCGGAGGCAACTAATCTTCGCCACATCAACATAGGAGACCTTGTTAGGGATAAGAAGTTGCACGATGGTTGGGACGACGAACTCGAATGCTACGTCATCAATGAAGATCTGGTTTGTGACGAACTTGAGGAAATAATGGAAGGCGGAGGGAACATCGTTGACCACCACGGCTGCGACTTCTTTCCGGA...

Protein

Download Protein FASTA

169 aa · TkA01G077380|TK1151|PROTEIN

MRSKPNILVTGTPGTGKTTTSAALAEATNLRHINIGDLVRDKKLHDGWDDELECYVINEDLVCDELEEIMEGGGNIVDHHGCDFFPERWFDRVVVLQTENSILFDRLSKRGYTGAKLTNNIECEIFQVLLEEAKDSYKEEIVVAMKSDSVDDMNSNVATISEWVRSWRV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G077380`
TK1151 ID	TkA01G077380
OH-1004 ID	LXL04_005188
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G077380

Location Chr01:19746740-19747854 (-)

Description Similar to AAK6: Adenylate kinase isoenzyme 6 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60340`	Broad-specificity nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates.	Identification of a novel nuclear-localized adenylate kinase 6 from Arabidopsis thaliana as an essential stem growth factor.2012 · DOI: 10.1016/j.plaphy.2012.10.002

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005188 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0015949 nucleobase-containing small molecule interconversion Biological Process

GO:0030490 maturation of SSU-rRNA Biological Process

GO:0042274 ribosomal small subunit biogenesis Biological Process

GO:0080186 developmental vegetative growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005813 centrosome Cellular Component

GO:0015030 Cajal body Cellular Component

KEGG gene cross-reference

ath:AT5G60340

bta:102216273

ddi:DDB_G0278493

hsa:102157402

mmu:102216272

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.685

Rank 1 · TkA01G077380 · TK1151

Cytoplasm0.555

Rank 2 · TkA01G077380 · TK1151

Mitochondrion0.062

Rank 3 · TkA01G077380 · TK1151

Cell membrane0.033

Rank 4 · TkA01G077380 · TK1151

Endoplasmic reticulum0.028

Rank 5 · TkA01G077380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01695IstB_IS212-29 aa

PF12775AAA_72-29 aa

PF13401AAA_223-30 aa

PF00437T2SSE3-35 aa

PF13191AAA_163-29 aa

PF01580FtsK_SpoIIIE3-23 aa

PF13245AAA_194-28 aa

PF13479AAA_244-25 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G077380	`PF01695`	IstB_IS21	2	29	0.053	13.7
TkA01G077380	`PF12775`	AAA_7	2	29	0.26	11.5
TkA01G077380	`PF13401`	AAA_22	3	30	0.0015	19.6
TkA01G077380	`PF00437`	T2SSE	3	35	0.0031	16.9
TkA01G077380	`PF13191`	AAA_16	3	29	0.0039	18.4
TkA01G077380	`PF01580`	FtsK_SpoIIIE	3	23	0.12	12.5
TkA01G077380	`PF13245`	AAA_19	4	28	0.0058	17.5
TkA01G077380	`PF13479`	AAA_24	4	25	0.028	14.8
TkA01G077380	`PF04851`	ResIII	5	69	0.0016	19.1
TkA01G077380	`PF06745`	ATPase	5	22	0.051	13.7
TkA01G077380	`PF20720`	nSTAND3	6	29	0.0055	17.1
TkA01G077380	`PF07728`	AAA_5	6	29	0.016	16.0
TkA01G077380	`PF08433`	KTI12	6	59	0.016	15.4
TkA01G077380	`PF03266`	NTPase_1	6	34	0.022	15.3
TkA01G077380	`PF09848`	SLFN-g3_helicase	6	28	0.1	12.6
TkA01G077380	`PF24883`	NPHP3_N	6	27	0.15	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJI1`	Arabidopsis thaliana	sp\|Q9FJI1\|KAD6_ARATH Adenylate kinase isoenzyme 6 homolog	64.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card