TkA01G075760 | RubberDandelionOmics

Gene overview

TkA01G075760

Reference: TK1151 Chr: Chr01 Coordinates: 19381110-19381648 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · TkA01G075760|TK1151|cDNA

ATGTCTTCTTCATCTTCCTACAACCAGTTCGCTCACTTAGAAATCCCCCTGGAAGAATTAGCATATGCCACCAACAACTTCCCTGATGAAAATCTCATTAAAGGAAGCGAATTGGGAAAGGCATACAAGGGCAAGATCTTGCGGTCAGAGCAACTGATTGATATTATCGCACAGAGGTTCGATCATGAGCATAGGGAACGAGATGCTGAGTTCTGGAACGAGATTTATGGATTAAAGATCATCGTATACAAACACGAGAC...

CDS

Download CDS FASTA

480 bp · TkA01G075760|TK1151|CDS

ATGTCTTCTTCATCTTCCTACAACCAGTTCGCTCACTTAGAAATCCCCCTGGAAGAATTAGCATATGCCACCAACAACTTCCCTGATGAAAATCTCATTAAAGGAAGCGAATTGGGAAAGGCATACAAGGGCAAGATCTTGCGGTCAGAGCAACTGATTGATATTATCGCACAGAGGTTCGATCATGAGCATAGGGAACGAGATGCTGAGTTCTGGAACGAGATTTATGGATTAAAGATCATCGTATACAAACACGAGAC...

Protein

Download Protein FASTA

159 aa · TkA01G075760|TK1151|PROTEIN

MSSSSSYNQFAHLEIPLEELAYATNNFPDENLIKGSELGKAYKGKILRSEQLIDIIAQRFDHEHRERDAEFWNEIYGLKIIVYKHETKGSLDTFLRDPNLTWMRRLKIYVGIAHTLSYIHYDDGRDFSVIHCDCDIRSSKILLDDDWEAKLSGFELSMK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G075760`
TK1151 ID	TkA01G075760
OH-1004 ID	LXL04_032791
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.200
Protein coverage (%)	TK1151 100.000 / OH-1004 63.281 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G075760

Location Chr01:19381110-19381648 (+)

Description Similar to ANX1: Receptor-like protein kinase ANXUR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At5g18500`	Probable receptor-like protein kinase At5g18500.	No verified direct reference in this release
`At3g24790`	May be involved in plant defense signaling.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0618700`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).	Analysis of flagellin perception mediated by flg22 receptor OsFLS2 in rice.2008 · DOI: 10.1094/mpmi-21-12-1635 Rice OsFLS2-Mediated Perception of Bacterial Flagellins Is Evaded by Xanthomonas oryzae pvs. oryzae and oryzicola.2015 · DOI: 10.1016/j.molp.2015.01.012

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032791 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0043680 filiform apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G23200

ath:AT3G04690

ath:AT3G46290

ath:AT5G28680

ath:AT5G39000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.471

Rank 1 · TkA01G075760 · TK1151

Cell membrane0.312

Rank 2 · TkA01G075760 · TK1151

Nucleus0.283

Rank 3 · TkA01G075760 · TK1151

Endoplasmic reticulum0.069

Rank 4 · TkA01G075760 · TK1151

Extracellular0.037

Rank 5 · TkA01G075760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr37-76 aa

PF29315BUD8_BUD9_C78-117 aa

PF07714PK_Tyr_Ser-Thr80-157 aa

PF00069Pkinase81-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G075760	`PF07714`	PK_Tyr_Ser-Thr	37	76	0.00014	22.0
TkA01G075760	`PF29315`	BUD8_BUD9_C	78	117	0.0094	17.2
TkA01G075760	`PF07714`	PK_Tyr_Ser-Thr	80	157	0.00014	22.0
TkA01G075760	`PF00069`	Pkinase	81	157	0.05	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E8W4`	Arabidopsis thaliana	sp\|Q3E8W4\|ANX2_ARATH Receptor-like protein kinase ANXUR2	32.700%	Swiss-Prot	Medium
`Q9SR05`	Arabidopsis thaliana	sp\|Q9SR05\|ANX1_ARATH Receptor-like protein kinase ANXUR1	33.300%	Swiss-Prot	Medium
`Q8LEB6`	Arabidopsis thaliana	sp\|Q8LEB6\|Y5185_ARATH Probable receptor-like protein kinase At5g18500	27.500%	Swiss-Prot	Low
`Q9LRY1`	Arabidopsis thaliana	sp\|Q9LRY1\|PBL25_ARATH Probable serine/threonine-protein kinase PBL25	32.900%	Swiss-Prot	Medium
`Q0JA29`	Oryza sativa subsp. japonica	sp\|Q0JA29\|FLS2_ORYSJ LRR receptor-like serine/threonine-protein kinase FLS2	31.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card