TkA01G071160 | RubberDandelionOmics

Gene overview

TkA01G071160

Reference: TK1151 Chr: Chr01 Coordinates: 18227663-18228226 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · TkA01G071160|TK1151|cDNA

ATGAATTCAGGTGACGATGCTTCAGCTACAAGTTCTTCGGTTTCTTCCTTCGATAAATTCTTCAATCAATTAGCATCGCCCACTAGGAAACCCCCGATTCCTGTGTTTAATTACTTTGACGAGAACGGAGGCTGGAAGATATCTCCCGAGGAGCTTTTACGAACGAGTGAATGCTTCGCCATCTTCTCAGAGGCAATTTATCAAACACCTTCTGTGCATTGGCCTGCTTACGATTTGGAACTTTGGGGGAATTACTCCAG...

CDS

Download CDS FASTA

384 bp · TkA01G071160|TK1151|CDS

ATGAATTCAGGTGACGATGCTTCAGCTACAAGTTCTTCGGTTTCTTCCTTCGATAAATTCTTCAATCAATTAGCATCGCCCACTAGGAAACCCCCGATTCCTGTGTTTAATTACTTTGACGAGAACGGAGGCTGGAAGATATCTCCCGAGGAGCTTTTACGAACGAGTGAATGCTTCGCCATCTTCTCAGAGGCAATTTATCAAACACCTTCTGTGCATTGGCCTGCTTACGATTTGGAACTTTGGGGGAATTACTCCAG...

Protein

Download Protein FASTA

127 aa · TkA01G071160|TK1151|PROTEIN

MNSGDDASATSSSVSSFDKFFNQLASPTRKPPIPVFNYFDENGGWKISPEELLRTSECFAIFSEAIYQTPSVHWPAYDLELWGNYSRYSFNAIIRILHLLVRNDVRSCWSEVRSEVEGAGWRRSVDR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G071160`
TK1151 ID	TkA01G071160
OH-1004 ID	LXL04_005267
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G071160`
Location	Chr01:18227663-18228226 (+)
Description	Similar to BXL6: Probable beta-D-xylosidase 6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005267` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009627 systemic acquired resistance Biological Process GO:0009832 plant-type cell wall biogenesis Biological Process GO:0010214 seed coat development Biological Process GO:0031222 arabinan catabolic process Biological Process GO:0045493 xylan catabolic process Biological Process GO:0050832 defense response to fungus Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005576 extracellular region Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005773 vacuole Cellular Component GO:0005829 cytosol Cellular Component GO:0009505 plant-type cell wall Cellular Component
KEGG gene cross-reference	ath:AT1G78060 ath:AT5G09730 ath:AT5G10560 ath:AT5G49360 ath:AT5G64570 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.356

Rank 1 · TkA01G071160 · TK1151

Cytoplasm0.343

Rank 2 · TkA01G071160 · TK1151

Mitochondrion0.151

Rank 3 · TkA01G071160 · TK1151

Cell membrane0.106

Rank 4 · TkA01G071160 · TK1151

Plastid0.084

Rank 5 · TkA01G071160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13405EF-hand_635-54 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G071160	`PF13405`	EF-hand_6	35	54	0.19	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card