TkA01G070560 | RubberDandelionOmics

Gene overview

TkA01G070560

Reference: TK1151 Chr: Chr01 Coordinates: 18043840-18045993 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1346 bp · TkA01G070560|TK1151|cDNA

AAAGCCCTAAACGGCAAATAACGGAACACTCGCTGATATCTCTTTACTCATGGAAGAAAAAGGTTTGCTTGAAGAACAGCCATGGCGATTGCTCGAGTTTTACAGCGGCATTGGCGGCATGAGATATTCTGCGATTAAGGCTGGAGTGAAAGCACAAATGGTTGAAGCTTTCGACATAAACGACTTAGCTAATGATGTTTACGAGCATAATTTTGGACATCGGCCATTCCAGGGCAACATTCAGACGTTAAGTGCTACTG...

CDS

Download CDS FASTA

1026 bp · TkA01G070560|TK1151|CDS

ATGGAAGAAAAAGGTTTGCTTGAAGAACAGCCATGGCGATTGCTCGAGTTTTACAGCGGCATTGGCGGCATGAGATATTCTGCGATTAAGGCTGGAGTGAAAGCACAAATGGTTGAAGCTTTCGACATAAACGACTTAGCTAATGATGTTTACGAGCATAATTTTGGACATCGGCCATTCCAGGGCAACATTCAGACGTTAAGTGCTACTGATCTTGATCGTTACAGAGCAAACGTATGGCTTCTTTCTCCACCATGCCA...

Protein

Download Protein FASTA

341 aa · TkA01G070560|TK1151|PROTEIN

MEEKGLLEEQPWRLLEFYSGIGGMRYSAIKAGVKAQMVEAFDINDLANDVYEHNFGHRPFQGNIQTLSATDLDRYRANVWLLSPPCQPYTRQGLQKQSADARASSFLQILEIIPQLKLPPSMLFVENVVGFETSDTHEKMIQILEENQFVTQEFILSPLQFGVPYSRPRYFCLAKRKPLSFSNPEFNGQLLHVPKPLLDENDELKTCLPIETFLEFQNGFLEGSINQYLVPSNLIERWGNAMDIVYPDSKRCCCFTKSYY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G070560`
TK1151 ID	TkA01G070560
OH-1004 ID	LXL04_038389
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.200
Protein coverage (%)	TK1151 94.135 / OH-1004 91.573 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G070560

Location Chr01:18043840-18045993 (+)

Description Similar to DNMT2: tRNA (cytosine(38)-C(5))-methyltransferase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25480`	Specifically methylates cytosine 38 in the anticodon loop of tRNA(Asp) (By similarity).	Arabidopsis DNA methyltransferase AtDNMT2 associates with histone deacetylase AtHD2s activity.2010 · DOI: 10.1016/j.bbrc.2010.03.119

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038389 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000281 mitotic cytokinesis Biological Process

GO:0001975 response to amphetamine Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006400 tRNA modification Biological Process

GO:0006998 nuclear envelope organization Biological Process

GO:0008033 tRNA processing Biological Process

GO:0010526 transposable element silencing Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0019954 asexual reproduction Biological Process

GO:0030435 sporulation resulting in formation of a cellular spore Biological Process

KEGG gene cross-reference

ath:AT5G25480

bta:353353

ddi:DDB_G0288047

hsa:1787

rno:291324

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.615

Rank 1 · TkA01G070560 · TK1151

Cytoplasm0.448

Rank 2 · TkA01G070560 · TK1151

Mitochondrion0.117

Rank 3 · TkA01G070560 · TK1151

Cell membrane0.039

Rank 4 · TkA01G070560 · TK1151

Endoplasmic reticulum0.034

Rank 5 · TkA01G070560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00145DNA_methylase13-335 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G070560	`PF00145`	DNA_methylase	13	335	1.9e-35	123.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JWT7`	Arabidopsis thaliana	sp\|F4JWT7\|TRDMT_ARATH tRNA (cytosine(38)-C(5))-methyltransferase 2	63.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card