TkA01G068740 | RubberDandelionOmics

Gene overview

TkA01G068740

Reference: TK1151 Chr: Chr01 Coordinates: 17609861-17610701 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · TkA01G068740|TK1151|cDNA

ATGAAATGGGTGCCGGCTGTCTTCACTCTTCAGTTCACTCTTCTTCGCGACTGCCTTCCGTCTTCAGTCTTCACCTCTCGTCCTCTCCACAGCTCCGATCCCAAATCGATTTCTCTTCCCGGCGCTCCCGCTCACAGCGACGCTCCCGGTCTTCACTGTCTTCTGCGAGACCTCCCCCGATTTCTTCACTATAATCAATTTGAATCGGCAAATCGATTTCCCCTCCCGGCGCTCCCAGATTGCTCTCCCTCTCGCTCACT...

CDS

Download CDS FASTA

519 bp · TkA01G068740|TK1151|CDS

ATGAAATGGGTGCCGGCTGTCTTCACTCTTCAGTTCACTCTTCTTCGCGACTGCCTTCCGTCTTCAGTCTTCACCTCTCGTCCTCTCCACAGCTCCGATCCCAAATCGATTTCTCTTCCCGGCGCTCCCGCTCACAGCGACGCTCCCGGTCTTCACTGTCTTCTGCGAGACCTCCCCCGATTTCTTCACTATAATCAATTTGAATCGGCAAATCGATTTCCCCTCCCGGCGCTCCCAGATTGCTCTCCCTCTCGCTCACT...

Protein

Download Protein FASTA

172 aa · TkA01G068740|TK1151|PROTEIN

MKWVPAVFTLQFTLLRDCLPSSVFTSRPLHSSDPKSISLPGAPAHSDAPGLHCLLRDLPRFLHYNQFESANRFPLPALPDCSPSRSLNRHVVLPPEVAKLLPKNRLLAETEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQNQENQAQLIRVYSCRVVFVFDTSDTN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G068740`
TK1151 ID	TkA01G068740
OH-1004 ID	LXL04_032987
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 37.791 / OH-1004 70.652 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G068740

Location Chr01:17609861-17610701 (-)

Description Similar to CKS2: Cyclin-dependent kinases regulatory subunit 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27960`	Associates with cyclin-dependent kinases (CDKs) and plays an essential role in the regulation of the cell cycle that affects plant growth rate.	CKS1At overexpression in Arabidopsis thaliana inhibits growth by reducing meristem size and inhibiting cell-cycle progression.2001 · DOI: 10.1046/j.1365-313x.2001.00996.x
`At2g27970`	Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XCH8`	Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.	No verified direct reference in this release
`Os03g0146300`	Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032987 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0051301 cell division Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity Molecular Function

GO:0019901 protein kinase binding Molecular Function

KEGG gene cross-reference

ath:AT2G27960

ath:AT2G27970

dosa:Os03g0146300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.413

Rank 1 · TkA01G068740 · TK1151

Nucleus0.404

Rank 2 · TkA01G068740 · TK1151

Mitochondrion0.208

Rank 3 · TkA01G068740 · TK1151

Cell membrane0.060

Rank 4 · TkA01G068740 · TK1151

Endoplasmic reticulum0.052

Rank 5 · TkA01G068740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01111CKS89-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G068740	`PF01111`	CKS	89	141	9.6e-26	90.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23249`	Arabidopsis thaliana	sp\|O23249\|CKS1_ARATH Cyclin-dependent kinases regulatory subunit 1	93.800%	Swiss-Prot	Low
`Q9SJJ5`	Arabidopsis thaliana	sp\|Q9SJJ5\|CKS2_ARATH Cyclin-dependent kinases regulatory subunit 2	86.800%	Swiss-Prot	Low
`A2XCH8`	Oryza sativa subsp. indica	sp\|A2XCH8\|CKS1_ORYSI Cyclin-dependent kinases regulatory subunit 1	94.800%	Swiss-Prot	Low
`Q6PS57`	Oryza sativa subsp. japonica	sp\|Q6PS57\|CKS1_ORYSJ Cyclin-dependent kinases regulatory subunit 1	94.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card