TkA01G068690 | RubberDandelionOmics

Gene overview

TkA01G068690

Reference: TK1151 Chr: Chr01 Coordinates: 17600518-17601651 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

759 bp · TkA01G068690|TK1151|cDNA

ATGGAAGATCATTGTGAAGCTGTTTTGATTGGAAGTGAAACTGATTACCGGCGTTTAATATCACAAAGATCTATAAATCGGGTGAACTACTTTTATCATTTAAACAGCATCGCAACGAAAAAGTACGAGGATATGTGGGATGAAGTCATACAAAATTATGGTCAACGTGTCAAGTCTGAAACCATTTCAGTAATGTTTGGAAGAACCCTAGAAGTTCCTGAAAGCTGTAACGGGATGGCCAAATTTACATTTGAATATTT...

CDS

Download CDS FASTA

759 bp · TkA01G068690|TK1151|CDS

ATGGAAGATCATTGTGAAGCTGTTTTGATTGGAAGTGAAACTGATTACCGGCGTTTAATATCACAAAGATCTATAAATCGGGTGAACTACTTTTATCATTTAAACAGCATCGCAACGAAAAAGTACGAGGATATGTGGGATGAAGTCATACAAAATTATGGTCAACGTGTCAAGTCTGAAACCATTTCAGTAATGTTTGGAAGAACCCTAGAAGTTCCTGAAAGCTGTAACGGGATGGCCAAATTTACATTTGAATATTT...

Protein

Download Protein FASTA

252 aa · TkA01G068690|TK1151|PROTEIN

MEDHCEAVLIGSETDYRRLISQRSINRVNYFYHLNSIATKKYEDMWDEVIQNYGQRVKSETISVMFGRTLEVPESCNGMAKFTFEYLCGRPLGAADYIAVAKNYHTVFVSDIPMMSMRIRDKARRFIILIDELYNHHCCLYCSAASSIDELFQGTEEGTLFDLESFQFETEAEGSKLRRDVLAEGSIGSGGAPAGIISMLSGKEEMFAFRRAVCLFLSLSLYIYIYRYMVYLYMYCDKALFEMANLPRKQED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G068690`
TK1151 ID	TkA01G068690
OH-1004 ID	LXL04_028266
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	35.900
Protein coverage (%)	TK1151 60.714 / OH-1004 29.200 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G068690`
Location	Chr01:17600518-17601651 (+)
Description	Similar to AFG1L: AFG1-like ATPase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028266` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0003341 cilium movement Biological Process GO:0007005 mitochondrion organization Biological Process GO:0035694 mitochondrial protein catabolic process Biological Process GO:0141164 mitochondrial protein quality control Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0005524 ATP binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function
KEGG gene cross-reference	dre:555926 hsa:246269 mmu:215951 rno:502479 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.576

Rank 1 · TkA01G068690 · TK1151

Nucleus0.399

Rank 2 · TkA01G068690 · TK1151

Mitochondrion0.125

Rank 3 · TkA01G068690 · TK1151

Golgi apparatus0.055

Rank 4 · TkA01G068690 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA01G068690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03969AFG1_ATPase2-156 aa

PF01637ATPase_226-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G068690	`PF03969`	AFG1_ATPase	2	156	2e-26	93.6
TkA01G068690	`PF01637`	ATPase_2	26	153	0.12	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card