TkA01G067240 | RubberDandelionOmics

Gene overview

TkA01G067240

Reference: TK1151 Chr: Chr01 Coordinates: 17207039-17207683 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · TkA01G067240|TK1151|cDNA

ATGGCAACATCATCAGTTACCGCAAGTGGGTTTTCTTCTTCCTTCCATGGAAGTTGGGGAACTTCAATGGCAGCCACACCCAAGCGGGTTCGAATTGAGAATCCATTAAGATATGGTCCGATGATGGGAAACGTTAACGAAGGAAAATGGCTTTTTGCTCCGGTAGTTGTCGTCACACGAAACATCGTTGGAAAGAAGCGATTCAATCAGCTTAGAGGAAAAGCAATTGCGTTACACTCTCAGGTGATTACGGAGTTCTG...

CDS

Download CDS FASTA

345 bp · TkA01G067240|TK1151|CDS

ATGGCAACATCATCAGTTACCGCAAGTGGGTTTTCTTCTTCCTTCCATGGAAGTTGGGGAACTTCAATGGCAGCCACACCCAAGCGGGTTCGAATTGAGAATCCATTAAGATATGGTCCGATGATGGGAAACGTTAACGAAGGAAAATGGCTTTTTGCTCCGGTAGTTGTCGTCACACGAAACATCGTTGGAAAGAAGCGATTCAATCAGCTTAGAGGAAAAGCAATTGCGTTACACTCTCAGGTGATTACGGAGTTCTG...

Protein

Download Protein FASTA

114 aa · TkA01G067240|TK1151|PROTEIN

MATSSVTASGFSSSFHGSWGTSMAATPKRVRIENPLRYGPMMGNVNEGKWLFAPVVVVTRNIVGKKRFNQLRGKAIALHSQVITEFCKSIGADSKQRQGLMFFVRFLFLVCNIN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G067240`
TK1151 ID	TkA01G067240
OH-1004 ID	LXL04_005312
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	87.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G067240

Location Chr01:17207039-17207683 (+)

Description Similar to PGR5: Protein PROTON GRADIENT REGULATION 5, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g05620`	Critical for growth under fluctuating-light conditions.	PGR5 is involved in cyclic electron flow around photosystem I and is essential for photoprotection in Arabidopsis.2002 · DOI: 10.1016/s0092-8674(02)00867-x The role of PGR5 in the redox poising of photosynthetic electron transport.2007 · DOI: 10.1016/j.bbabio.2007.07.007 A balanced PGR5 level is required for chloroplast development and optimum operation of cyclic electron transport around photosystem I.2007 · DOI: 10.1093/pcp/pcm116 Genetic characterization of a flap1 null mutation in Arabidopsis npq4 and pgr5 plants suggests that the regulatory role of FLAP1 involves the control of proton homeostasis in chloroplasts.2019 · DOI: 10.1007/s11120-018-0575-z Arabidopsis mutants lacking DLDG1 and non-photochemical quenching-related proteins reveal the regulatory role of DLDG1 in chloroplast pH homeostasis.2023 · DOI: 10.1002/1873-3468.14687

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005312 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009773 photosynthetic electron transport in photosystem I Biological Process

GO:0010117 photoprotection Biological Process

GO:0071484 cellular response to light intensity Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009055 electron transfer activity Molecular Function

KEGG gene cross-reference

ath:AT2G05620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.908

Rank 1 · TkA01G067240 · TK1151

Mitochondrion0.078

Rank 2 · TkA01G067240 · TK1151

Nucleus0.042

Rank 3 · TkA01G067240 · TK1151

Cytoplasm0.028

Rank 4 · TkA01G067240 · TK1151

Cell membrane0.016

Rank 5 · TkA01G067240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SL05`	Arabidopsis thaliana	sp\|Q9SL05\|PGR5_ARATH Protein PROTON GRADIENT REGULATION 5, chloroplastic	59.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card