RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G066480
Reference: TK1151 Chr: Chr01 Coordinates: 16979109-16981054 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1243 bp · TkA01G066480|TK1151|cDNA

ATCACGTATCAAATGTATAGAAATGGTACATTTAAGTATCATATGTGTGGGAATGGTTCATGAATTTATTTAACAAAATGAAAATATAATGAAATTGCAATTGAAAGTCACTCTCCCCCTTTGGTTTGATAAACTATAGCGTAGAGTTATTATATTTGGTGGGTCCAAACAAACTACACTTCCGTACTATTCTTTTTCAGTATCACAATAACACATGAACATGAAAAGCTTAGTAATCCTGCCTTCCATGCAGTTTTTTC...

CDS

Download CDS FASTA

660 bp · TkA01G066480|TK1151|CDS

ATGACGATTCTTTACACGATGGTGGCCAGAGGATCTGTTCTGTTGGCGGAATTCAGTGGTACGTCGACCAACGCGAGCACTATCGCCAGGCAAATTCTCGAGAAAATCCCTGGGAACAATGATATGAATGTCTCTTACTCGCAAGATCGGTATATTTTCCATGTTAAGCGTACTGATGGCCTCACTATTCTCTGTATGGCCGATGATGATGCCGGAAGACGAATTCCTTTCACATTTCTCGAAGACATTCATCAGAGATT...

Protein

Download Protein FASTA

219 aa · TkA01G066480|TK1151|PROTEIN

MTILYTMVARGSVLLAEFSGTSTNASTIARQILEKIPGNNDMNVSYSQDRYIFHVKRTDGLTILCMADDDAGRRIPFTFLEDIHQRFVRTYGRAVLTAQAYDMNDEFSRVLSQQMEYYSSDPNADRINRLKGEMSQVRSVMIQNIDKVLERGDRLETLVDKTANMQTNTFRFRKQSRRFRNTMWWKNVKLMVAMVILLLVIVYFVLAFVCKGFGLPACL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G066480
TK1151 IDTkA01G066480
OH-1004 IDLXL04_032373
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)79.900
Protein coverage (%)TK1151 100.000 / OH-1004 99.545
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G066480
LocationChr01:16979109-16981054 (-)
DescriptionSimilar to VAMP713: Vesicle-associated membrane protein 713
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g25340 Involved in the targeting and/or fusion of transport vesicles to their target membrane. No verified direct reference in this release
At4g32150 Involved in the targeting and/or fusion of transport vesicles to their target membrane. No verified direct reference in this release
At5g11150 Involved in the targeting and/or fusion of transport vesicles to their target membrane. No verified direct reference in this release
At5g22360 Involved in the targeting and/or fusion of transport vesicles to their target membrane. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032373 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006906 vesicle fusion Biological Process
GO:0008333 endosome to lysosome transport Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0010118 stomatal movement Biological Process
GO:0015031 protein transport Biological Process
GO:0016192 vesicle-mediated transport Biological Process
GO:0061025 membrane fusion Biological Process
GO:0098876 vesicle-mediated transport to the plasma membrane Biological Process
GO:1901703 protein localization involved in auxin polar transport Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0000325 plant-type vacuole Cellular Component
KEGG gene cross-reference
ath:AT2G25340
ath:AT4G32150
ath:AT5G11150
ath:AT5G22360
ddi:DDB_G0277173
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.343
Rank 1 · TkA01G066480 · TK1151
Lysosome / Vacuole0.340
Rank 2 · TkA01G066480 · TK1151
Golgi apparatus0.333
Rank 3 · TkA01G066480 · TK1151
Cell membrane0.177
Rank 4 · TkA01G066480 · TK1151
Endoplasmic reticulum0.149
Rank 5 · TkA01G066480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13774Longin15-111 aa
PF30241MavE23-38 aa
PF11101DUF288482-163 aa
PF20797HepT-like_291-149 aa
PF04678MCU115-206 aa
PF28533DUF8429122-148 aa
PF30241MavE124-147 aa
PF00957Synaptobrevin126-205 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G066480PF13774Longin151112.9e-2795.4
TkA01G066480PF30241MavE23380.3311.7
TkA01G066480PF11101DUF2884821630.1312.5
TkA01G066480PF20797HepT-like_2911490.2512.2
TkA01G066480PF04678MCU1152060.02715.3
TkA01G066480PF28533DUF84291221480.3511.5
TkA01G066480PF30241MavE1241470.3311.7
TkA01G066480PF00957Synaptobrevin1262052.7e-29101.6
TkA01G066480PF05478Prominin1302140.01813.9
TkA01G066480PF12259Baculo_F1402091.97.7
TkA01G066480PF30241MavE1421930.3311.7
TkA01G066480PF20797HepT-like_21621820.2512.2
TkA01G066480PF06024Orf781652060.02515.6
TkA01G066480PF28533DUF84291912060.3511.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SIQ9Arabidopsis thalianasp|Q9SIQ9|VA712_ARATH Vesicle-associated membrane protein 71274.300%Swiss-ProtHigh
O49377Arabidopsis thalianasp|O49377|VA711_ARATH Vesicle-associated membrane protein 71173.500%Swiss-ProtHigh
Q9LFP1Arabidopsis thalianasp|Q9LFP1|VA713_ARATH Vesicle-associated membrane protein 71371.700%Swiss-ProtHigh
Q9FMR5Arabidopsis thalianasp|Q9FMR5|VA714_ARATH Vesicle-associated membrane protein 71454.800%Swiss-ProtHigh

JBrowse

View in Genome Browser