TkA01G064670 | RubberDandelionOmics

Gene overview

TkA01G064670

Reference: TK1151 Chr: Chr01 Coordinates: 16607054-16608963 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1751 bp · TkA01G064670|TK1151|cDNA

CAACCCACCGTTTGCATCGAAAGGAATAAACCCTAGTCCTACCGCCGACGGTAGATCAGTATCTCCTTCGTTTACATCATCAAATTAAGCTTAGCACCAAAATACAAAACCCCGACATTACTCCGGCAAACGTTCAGTATCTCCGGCCATGTATAGGGTAGCTAGTGCGTCAGAGTATTTGGTGATCACCGGATTCGGGATCGAAGACGTCAAAATCGCAAAGAAAGCATGGGTATATCCCGGCCAGACCTGGGCCCGAT...

CDS

Download CDS FASTA

1473 bp · TkA01G064670|TK1151|CDS

ATGTATAGGGTAGCTAGTGCGTCAGAGTATTTGGTGATCACCGGATTCGGGATCGAAGACGTCAAAATCGCAAAGAAAGCATGGGTATATCCCGGCCAGACCTGGGCCCGATTCGACATAACTCCGGTCAACTACACATTCGATGTACAGGCCATGAGCGCCGAGAAACTCCCCTTCATCCTCCCGGCAGTATTCACAATTGGTCCCCGTGCCGACGACGACGAGAGTCTCCATAAATACGCCAAGCTGATCTCCTCATT...

Protein

Download Protein FASTA

490 aa · TkA01G064670|TK1151|PROTEIN

MYRVASASEYLVITGFGIEDVKIAKKAWVYPGQTWARFDITPVNYTFDVQAMSAEKLPFILPAVFTIGPRADDDESLHKYAKLISSFDKRSRHLNDLVMGIIEGETRVLAASMTMDEIFKGTKDFKKEVFDKVQWELNQFGLWIYNANVKQLVDVPGHEYFSYLGQKIQQEAANQAKIDVSEAQMKGEIGSKLREGQTLQNAAKIDAETKIIATQREGQGKKEEVKVMTEVKIFENQREAEVAEANAELAMKKSKWAKDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G064670`
TK1151 ID	TkA01G064670
OH-1004 ID	LXL04_005331
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G064670`
Location	Chr01:16607054-16608963 (+)
Description	Similar to FLOT1: Flotillin-like protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005331` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009877 nodulation Biological Process GO:0048364 root development Biological Process GO:0005886 plasma membrane Cellular Component GO:0016324 apical plasma membrane Cellular Component
KEGG gene cross-reference	mtr:11408733 mtr:11426749 mtr:11427312 mtr:11433510 mtr:25490026 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.697

Rank 1 · TkA01G064670 · TK1151

Cytoplasm0.325

Rank 2 · TkA01G064670 · TK1151

Nucleus0.139

Rank 3 · TkA01G064670 · TK1151

Golgi apparatus0.044

Rank 4 · TkA01G064670 · TK1151

Mitochondrion0.044

Rank 5 · TkA01G064670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01145Band_75-184 aa

PF27170SH3_Rv2311173-218 aa

PF01145Band_7227-248 aa

PF18223PilJ_C276-362 aa

PF01145Band_7320-338 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G064670	`PF01145`	Band_7	5	184	1.1e-19	71.8
TkA01G064670	`PF27170`	SH3_Rv2311	173	218	0.17	12.7
TkA01G064670	`PF01145`	Band_7	227	248	1.1e-19	71.8
TkA01G064670	`PF18223`	PilJ_C	276	362	0.17	12.9
TkA01G064670	`PF01145`	Band_7	320	338	1.1e-19	71.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card