TkA01G062310 | RubberDandelionOmics

Gene overview

TkA01G062310

Reference: TK1151 Chr: Chr01 Coordinates: 16057469-16058151 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · TkA01G062310|TK1151|cDNA

ATGCCTAACGAGACTTTATCCAAGCACTTATTCCATTGGGAAAATCAACCACTCAAATGGTCTATACGATTACGAGTAGCTTTATATCTAGCTCAAGCATTAGAGTATTCTAGCAACAAAGGCCGATCCTTAAGTCACGATCTTAATGCCTATAGAGTATTATTTGATCATGATTGCAATCCGAGACTCTCGTGCTTCGGGCTAATGAAGAATAGCCGAGATGGAAAAAGTTACAGTACTAATTTAGCTTTCACACCTCC...

CDS

Download CDS FASTA

357 bp · TkA01G062310|TK1151|CDS

ATGCCTAACGAGACTTTATCCAAGCACTTATTCCATTGGGAAAATCAACCACTCAAATGGTCTATACGATTACGAGTAGCTTTATATCTAGCTCAAGCATTAGAGTATTCTAGCAACAAAGGCCGATCCTTAAGTCACGATCTTAATGCCTATAGAGTATTATTTGATCATGATTGCAATCCGAGACTCTCGTGCTTCGGGCTAATGAAGAATAGCCGAGATGGAAAAAGTTACAGTACTAATTTAGCTTTCACACCTCC...

Protein

Download Protein FASTA

118 aa · TkA01G062310|TK1151|PROTEIN

MPNETLSKHLFHWENQPLKWSIRLRVALYLAQALEYSSNKGRSLSHDLNAYRVLFDHDCNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYMKTGLTRVGTLIITKGRRNDVNEECRSES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G062310`
TK1151 ID	TkA01G062310
OH-1004 ID	LXL04_005349
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G062310

Location Chr01:16057469-16058151 (+)

Description Similar to BSK8: Serine/threonine-protein kinase BSK8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41260`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175 A kinase-phosphatase signaling module with BSK8 and BSL2 involved in regulation of sucrose-phosphate synthase.2014 · DOI: 10.1021/pr5003164
`At5g59010`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	A mutation in Arabidopsis BSK5 encoding a brassinosteroid-signaling kinase protein affects responses to salinity and abscisic acid.2012 · DOI: 10.1016/j.bbrc.2012.08.118
`At3g54030`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	No verified direct reference in this release
`At1g63500`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	No verified direct reference in this release
`At4g00710`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.2008 · DOI: 10.1126/science.1156973 BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005349 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G63500

ath:AT4G00710

ath:AT5G41260

ath:AT5G59010

dosa:Os04g0684200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.443

Rank 1 · TkA01G062310 · TK1151

Nucleus0.373

Rank 2 · TkA01G062310 · TK1151

Cell membrane0.227

Rank 3 · TkA01G062310 · TK1151

Mitochondrion0.068

Rank 4 · TkA01G062310 · TK1151

Endoplasmic reticulum0.046

Rank 5 · TkA01G062310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr6-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G062310	`PF07714`	PK_Tyr_Ser-Thr	6	92	0.00098	19.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHD7`	Arabidopsis thaliana	sp\|Q9FHD7\|BSK8_ARATH Serine/threonine-protein kinase BSK8	75.200%	Swiss-Prot	High
`Q9FIL1`	Arabidopsis thaliana	sp\|Q9FIL1\|BSK5_ARATH Serine/threonine-protein kinase BSK5	84.900%	Swiss-Prot	High
`Q9M324`	Arabidopsis thaliana	sp\|Q9M324\|BSK6_ARATH Serine/threonine-protein kinase BSK6	76.200%	Swiss-Prot	High
`F4I3M3`	Arabidopsis thaliana	sp\|F4I3M3\|BSK7_ARATH Serine/threonine-protein kinase BSK7	82.800%	Swiss-Prot	High
`Q8W4L3`	Arabidopsis thaliana	sp\|Q8W4L3\|BSK3_ARATH Serine/threonine-protein kinase BSK3	82.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card