TkA01G055620 | RubberDandelionOmics

Gene overview

TkA01G055620

Reference: TK1151 Chr: Chr01 Coordinates: 14403433-14404864 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1255 bp · TkA01G055620|TK1151|cDNA

ATTAAATTCAACCAAATGGAACCACTTTTGGCAAAGTGCAATCGTCGTCACATTGAAATGACTCTCTCAATTCCAATGCAATAAATCCCCTTTAAAATCTTTGAGCCATCGCCCCTTGAGCTTCCCACGCCTGAAAATCATCGAGCAGAGAGAAATATATGACCTTAACATAAGAAAAACAGCATCTCTCTAGCTAACATAGAGATGGATCTTAACAGCAATAACAAAGAATGGCATACCTGTACCACAATTAGGAACTG...

CDS

Download CDS FASTA

567 bp · TkA01G055620|TK1151|CDS

ATGCAGAAGCTTAGCCCCGTACATATGGCAGGATCGATTTGGGACGAACGTGGCAAGCCTGAAATTGTACAAATACTGATTTCACATAACGAAAATCGCATCGAATCGATACAGTTCGTATATGTCGTGGATGGGAAGCTGCTTCGTTCAGAAATCCATGGAAATACCACCTGTCAAAATAGATTTGCTGCCGTGGGGTTTAATTACCCAAGTGAGTATTTAGTTTCTGTAAGTGGTTGGCATAGAGACTATAATGGCGA...

Protein

Download Protein FASTA

188 aa · TkA01G055620|TK1151|PROTEIN

MQKLSPVHMAGSIWDERGKPEIVQILISHNENRIESIQFVYVVDGKLLRSEIHGNTTCQNRFAAVGFNYPSEYLVSVSGWHRDYNGDLASITFGTNKRTYGPFGSPNDADNDRNKFDYNFSPRSSFGGFHGSIVGYKSSLSIGVYIKPVVSLVEFGAFRKPRMIGFLVNFFALLIISMVFLWYNIGVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G055620`
TK1151 ID	TkA01G055620
OH-1004 ID	LXL04_005401
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	70.300
Protein coverage (%)	TK1151 81.915 / OH-1004 30.038 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G055620

Location Chr01:14403433-14404864 (-)

Description Similar to RTM1: Inactive protein RESTRICTED TEV MOVEMENT 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: D9UBI3`	Unable to mediate restriction of long-distance movement of the pathogenic tobacco etch virus (TEV) without causing a hypersensitive response or inducing systemic acquired resistance.	No verified direct reference in this release
`At1g05760`	Required for the restriction of long-distance movement of the pathogenic tobacco etch virus (TEV) without causing a hypersensitive response or inducing systemic acquired resistance.	Cloning of the Arabidopsis RTM1 gene, which controls restriction of long-distance movement of tobacco etch virus.2000 · DOI: 10.1073/pnas.97.1.489 Arabidopsis RTM2 gene is necessary for specific restriction of tobacco etch virus and encodes an unusual small heat shock-like protein.2000 · DOI: 10.1105/tpc.12.4.569 Identification and characterization of a locus (RTM1) that restricts long-distance movement of tobacco etch virus in Arabidopsis thaliana.1998 · DOI: 10.1046/j.1365-313x.1998.00105.x
`UniProt: D9UBG0`	Unable to mediate restriction of long-distance movement of the pathogenic tobacco etch virus (TEV) without causing a hypersensitive response or inducing systemic acquired resistance.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005401 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009615 response to virus Biological Process

GO:0046741 transport of virus in host, tissue to tissue Biological Process

GO:0051607 defense response to virus Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G05760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.243

Rank 1 · TkA01G055620 · TK1151

Lysosome / Vacuole0.188

Rank 2 · TkA01G055620 · TK1151

Cell membrane0.174

Rank 3 · TkA01G055620 · TK1151

Endoplasmic reticulum0.163

Rank 4 · TkA01G055620 · TK1151

Extracellular0.149

Rank 5 · TkA01G055620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01419Jacalin10-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G055620	`PF01419`	Jacalin	10	133	7e-23	82.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`D9UBI3`	Arabidopsis thaliana	sp\|D9UBI3\|RTM1A_ARATH Inactive protein RESTRICTED TEV MOVEMENT 1	40.500%	Swiss-Prot	Medium
`Q9SE37`	Arabidopsis thaliana	sp\|Q9SE37\|JAL1_ARATH Protein RESTRICTED TEV MOVEMENT 1	40.500%	Swiss-Prot	Medium
`D9UBG0`	Arabidopsis thaliana	sp\|D9UBG0\|RTM1B_ARATH Inactive protein RESTRICTED TEV MOVEMENT 1	39.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card