TkA01G054610 | RubberDandelionOmics

Gene overview

TkA01G054610

Reference: TK1151 Chr: Chr01 Coordinates: 14118272-14122980 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2286 bp · TkA01G054610|TK1151|cDNA

GGCGGTCAATTTAGGCCATCAAACTCCACAAGTGCCAACAATTTACAAACAACCATACAGCCATCTTCCCCTCTTAGCAGCCTGGTTTCTTTGAACACGGATATACATACAAAAAATATATGTATAATATATACATATACCTATTTTTGTTTGTCTACCTCATCTCTTCGCTATATATAAGTACTGCACGCCCATTTCTTTTCTCACACACTTCATAGCTCCCCACTCACCCATTTGACGAGGATTTACCAGTTTCTTAC...

CDS

Download CDS FASTA

1272 bp · TkA01G054610|TK1151|CDS

ATGGCGACTGGACAAATCTTCTCCCGTACAACACAAGCATTATTCTACAACTACAAACAGTTACCAATTCAACGGATGCTTGATTTTGACTTCCTTTGTGGGAGAGAAACACCATCAGTTGCTGGAATCATCAACCCTGGTGCAGAGGGATTCCAGAAACTATTTTTCGGTCAAGAGGAAATCGCCATTCCAGTACATTCAACAATCGAAGCAGCTTGTGCTGCACATCCTACTGCTGATGTATTCATAAACTTTGCATC...

Protein

Download Protein FASTA

423 aa · TkA01G054610|TK1151|PROTEIN

MATGQIFSRTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINPGAEGFQKLFFGQEEIAIPVHSTIEAACAAHPTADVFINFASFRSAAASSKLALKQPTIRVVAIIAEGVPESDTKELISYARSNTQFVIGPATVGGIQAGAFKIGDTAGTIDNIIQCKLYRPGSVGFVSKSGGMSNELYNTIARVTDGLYEGIAIGGDVFPGSTLSDHVLRFNNIPQIKMIVVLGELGGRDEYSLVEALKSGKISKPVCAWVSGT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G054610`
TK1151 ID	TkA01G054610
OH-1004 ID	LXL04_005407
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 81.797 / OH-1004 56.908 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G054610

Location Chr01:14118272-14122980 (-)

Description Similar to ACLB-1: ATP-citrate synthase beta chain protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49460`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	Molecular characterization of a heteromeric ATP-citrate lyase that generates cytosolic acetyl-coenzyme A in Arabidopsis.2002 · DOI: 10.1104/pp.008110
`At3g06650`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0300200`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005407 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006085 acetyl-CoA biosynthetic process Biological Process

GO:0006101 citrate metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0045335 phagocytic vesicle Cellular Component

GO:0140615 ATP-dependent citrate lyase complex Cellular Component

GO:0003878 ATP citrate synthase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016829 lyase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G06650

ath:AT5G49460

ddi:DDB_G0278345

dosa:Os01g0300200

spo:2539879

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.435

Rank 1 · TkA01G054610 · TK1151

Mitochondrion0.223

Rank 2 · TkA01G054610 · TK1151

Peroxisome0.160

Rank 3 · TkA01G054610 · TK1151

Nucleus0.145

Rank 4 · TkA01G054610 · TK1151

Plastid0.103

Rank 5 · TkA01G054610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13607Succ_CoA_lig99-128 aa

PF13607Succ_CoA_lig167-306 aa

PF00549Ligase_CoA173-298 aa

PF06345Drf_DAD239-248 aa

PF06345Drf_DAD341-346 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G054610	`PF13607`	Succ_CoA_lig	99	128	2e-05	25.1
TkA01G054610	`PF13607`	Succ_CoA_lig	167	306	2e-05	25.1
TkA01G054610	`PF00549`	Ligase_CoA	173	298	3.6e-18	66.7
TkA01G054610	`PF06345`	Drf_DAD	239	248	0.22	12.3
TkA01G054610	`PF06345`	Drf_DAD	341	346	0.22	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGX1`	Arabidopsis thaliana	sp\|Q9FGX1\|ACLB2_ARATH ATP-citrate synthase beta chain protein 2	83.400%	Swiss-Prot	High
`Q9C522`	Arabidopsis thaliana	sp\|Q9C522\|ACLB1_ARATH ATP-citrate synthase beta chain protein 1	82.600%	Swiss-Prot	High
`Q93VT8`	Oryza sativa subsp. japonica	sp\|Q93VT8\|ACLB1_ORYSJ ATP-citrate synthase beta chain protein 1	89.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card