TkA01G050620 | RubberDandelionOmics

Gene overview

TkA01G050620

Reference: TK1151 Chr: Chr01 Coordinates: 13113217-13113735 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · TkA01G050620|TK1151|cDNA

ATGAAGTTCTTCTCTCTTCTTCTCATATTTCTCTTTCTTGGCCTCTTTGAAGCTCCATTAATGGTGATGGGAGATAGAAAGCTGATAGAAAGCACGTGCAAGGCCACACCTTCATACAATCTTTGTCTCTCAACTCTCTTATCAAACCCCAAAAGTTTAAGTGGTGATGTTAGTGACTTGGGACTAATCATGGTGGGTGCAACTCGGATTAAGGCAACTCAAGCCGTACAACATATCAAGTCTCTTTATAGGTCACACCC...

CDS

Download CDS FASTA

519 bp · TkA01G050620|TK1151|CDS

ATGAAGTTCTTCTCTCTTCTTCTCATATTTCTCTTTCTTGGCCTCTTTGAAGCTCCATTAATGGTGATGGGAGATAGAAAGCTGATAGAAAGCACGTGCAAGGCCACACCTTCATACAATCTTTGTCTCTCAACTCTCTTATCAAACCCCAAAAGTTTAAGTGGTGATGTTAGTGACTTGGGACTAATCATGGTGGGTGCAACTCGGATTAAGGCAACTCAAGCCGTACAACATATCAAGTCTCTTTATAGGTCACACCC...

Protein

Download Protein FASTA

172 aa · TkA01G050620|TK1151|PROTEIN

MKFFSLLLIFLFLGLFEAPLMVMGDRKLIESTCKATPSYNLCLSTLLSNPKSLSGDVSDLGLIMVGATRIKATQAVQHIKSLYRSHPELRRPLNECAQMYLAVVKADVPSAIQALDGGQPKFAEDGMADTAVEAQACERSFSDGGHKSPVTEMNKGVENIANVARAIIRMLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G050620`
TK1151 ID	TkA01G050620
OH-1004 ID	LXL04_005432
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 90.526 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G050620`
Location	Chr01:13113217-13113735 (+)
Description	Similar to C/VIF1: Cell wall / vacuolar inhibitor of fructosidase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005432` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009827 plant-type cell wall modification Biological Process GO:0009860 pollen tube growth Biological Process GO:0043086 negative regulation of catalytic activity Biological Process GO:0005576 extracellular region Cellular Component GO:0005773 vacuole Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009507 chloroplast Cellular Component GO:0012505 endomembrane system Cellular Component GO:0048046 apoplast Cellular Component GO:0090404 pollen tube tip Cellular Component GO:0004857 enzyme inhibitor activity Molecular Function GO:0046910 pectinesterase inhibitor activity Molecular Function
KEGG gene cross-reference	ath:AT1G47960 ath:AT3G17220 ath:AT5G64620 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.501

Rank 1 · TkA01G050620 · TK1151

Lysosome / Vacuole0.163

Rank 2 · TkA01G050620 · TK1151

Endoplasmic reticulum0.131

Rank 3 · TkA01G050620 · TK1151

Cytoplasm0.119

Rank 4 · TkA01G050620 · TK1151

Cell membrane0.093

Rank 5 · TkA01G050620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04043PMEI27-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G050620	`PF04043`	PMEI	27	167	2.1e-18	67.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card