TkA01G050610 | RubberDandelionOmics

Gene overview

TkA01G050610

Reference: TK1151 Chr: Chr01 Coordinates: 13109245-13109691 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

447 bp · TkA01G050610|TK1151|cDNA

ATGATGATTCCCACCAATATTCTCGAACAAAACCCACTTGATCATCTCCCTAAAAACCTCGAAACCATCAATCTAGCACGCGCCGATTGGAAGGAGACGTCCGGGCATCACGAGATCACCCTGGATGTTCCTGGGTTGAAGAAAGAGGACATAAAGATCGAGGTGGAAGAGAGCCGGGTGTTGAAGGTAAGCGGAGAGAGGAAGGCGGAGGAAGAGGTCGACGGCGATAAGTGGCATAGGGCGGAGAGGACAAGTGGGAA...

CDS

Download CDS FASTA

447 bp · TkA01G050610|TK1151|CDS

ATGATGATTCCCACCAATATTCTCGAACAAAACCCACTTGATCATCTCCCTAAAAACCTCGAAACCATCAATCTAGCACGCGCCGATTGGAAGGAGACGTCCGGGCATCACGAGATCACCCTGGATGTTCCTGGGTTGAAGAAAGAGGACATAAAGATCGAGGTGGAAGAGAGCCGGGTGTTGAAGGTAAGCGGAGAGAGGAAGGCGGAGGAAGAGGTCGACGGCGATAAGTGGCATAGGGCGGAGAGGACAAGTGGGAA...

Protein

Download Protein FASTA

148 aa · TkA01G050610|TK1151|PROTEIN

MMIPTNILEQNPLDHLPKNLETINLARADWKETSGHHEITLDVPGLKKEDIKIEVEESRVLKVSGERKAEEEVDGDKWHRAERTSGKFWRQFRLSGNVDMEKIMAHLEDGVLKIKVPKLAQEKKQSRVIDIMGGESFNGDIKATKTDM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G050610`
TK1151 ID	TkA01G050610
OH-1004 ID	LXL04_005434
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 79.570 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G050610

Location Chr01:13109245-13109691 (-)

Description Similar to HSP22.0: 22.0 kDa heat shock protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10250`	22.0 kDa heat shock protein.	No verified direct reference in this release
`At5g59720`	18.1 kDa class I heat shock protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0445100`	23.2 kDa heat shock protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005434 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009408 response to heat Biological Process

GO:0009651 response to salt stress Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0051259 protein complex oligomerization Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0051082 unfolded protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G53540

ath:AT4G10250

dosa:Os04g0445100

gmx:100526965

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.687

Rank 1 · TkA01G050610 · TK1151

Nucleus0.314

Rank 2 · TkA01G050610 · TK1151

Peroxisome0.119

Rank 3 · TkA01G050610 · TK1151

Mitochondrion0.102

Rank 4 · TkA01G050610 · TK1151

Cell membrane0.059

Rank 5 · TkA01G050610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19100DUF57879-94 aa

PF17886ArsA_HSP2016-32 aa

PF04969CS27-118 aa

PF00011HSP2029-131 aa

PF27746Small_heat_shock_put32-117 aa

PF17886ArsA_HSP2035-58 aa

PF18046FKBP26_C40-60 aa

PF18046FKBP26_C96-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G050610	`PF19100`	DUF5787	9	94	0.049	14.1
TkA01G050610	`PF17886`	ArsA_HSP20	16	32	0.18	12.2
TkA01G050610	`PF04969`	CS	27	118	2.1e-07	32.5
TkA01G050610	`PF00011`	HSP20	29	131	4e-29	101.4
TkA01G050610	`PF27746`	Small_heat_shock_put	32	117	7.6e-05	22.8
TkA01G050610	`PF17886`	ArsA_HSP20	35	58	0.18	12.2
TkA01G050610	`PF18046`	FKBP26_C	40	60	0.0015	19.4
TkA01G050610	`PF18046`	FKBP26_C	96	121	0.0015	19.4
TkA01G050610	`PF27746`	Small_heat_shock_put	101	142	7.6e-05	22.8
TkA01G050610	`PF17886`	ArsA_HSP20	104	115	0.18	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38806`	Arabidopsis thaliana	sp\|Q38806\|HSP22_ARATH 22.0 kDa heat shock protein	53.500%	Swiss-Prot	High
`P19037`	Arabidopsis thaliana	sp\|P19037\|HS181_ARATH 18.1 kDa class I heat shock protein	54.600%	Swiss-Prot	High
`Q7XUW5`	Oryza sativa subsp. japonica	sp\|Q7XUW5\|HS232_ORYSJ 23.2 kDa heat shock protein	43.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card