TkA01G048980 | RubberDandelionOmics

Gene overview

TkA01G048980

Reference: TK1151 Chr: Chr01 Coordinates: 12660766-12661935 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1075 bp · TkA01G048980|TK1151|cDNA

AATGGCATCATTCTACCTTCAATAAGCATCCTGTGTGTTCTTATACTTCATCTCACTTCTCTTACCGATGGCGGCGGTGTTGGAATCAACTACGGATTACTCGGAAACAACCTCCCTTCTCCACCCCAAGTCGTAAACCTCTTAAAATCAAGAAACATAAAACGAATTCGCATCTTTAGCCCTGACGTCAACGTTCTCAACGCTCTACAAAACTCAGGAATCGAATTAATCATCGGAACCTTCAATCAAGACATACCCAA...

CDS

Download CDS FASTA

1014 bp · TkA01G048980|TK1151|CDS

AATGGCATCATTCTACCTTCAATAAGCATCCTGTGTGTTCTTATACTTCATCTCACTTCTCTTACCGATGGCGGCGGTGTTGGAATCAACTACGGATTACTCGGAAACAACCTCCCTTCTCCACCCCAAGTCGTAAACCTCTTAAAATCAAGAAACATAAAACGAATTCGCATCTTTAGCCCTGACGTCAACGTTCTCAACGCTCTACAAAACTCAGGAATCGAATTAATCATCGGAACCTTCAATCAAGACATACCCAA...

Protein

Download Protein FASTA

337 aa · TkA01G048980|TK1151|PROTEIN

NGIILPSISILCVLILHLTSLTDGGGVGINYGLLGNNLPSPPQVVNLLKSRNIKRIRIFSPDVNVLNALQNSGIELIIGTFNQDIPNLAGDLNFAKSWVLSKIVPYQRTIKFRCISIGNEVIPGGYTNQVYPAIQHMNTALQSLSLGYIPVTTTIALNSLASSSPPSTGDFKGDVKAEMRKIASFLNYKSYPLLVNVYPYFAYASAPGSISLPYVMFTSNDVVVRDGNLRYRNMFDAMVDAVYSALEKVNAGGVEVVITE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G048980`
TK1151 ID	TkA01G048980
OH-1004 ID	LXL04_005446
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 99.110 / OH-1004 99.110 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G048980

Location Chr01:12660766-12661935 (-)

Description Similar to Putative glucan endo-1,3-beta-glucosidase GVI (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20330`	May play a role in plant defense against pathogens.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005446 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0005773 vacuole Cellular Component

GO:0042972 licheninase activity Molecular Function

GO:0042973 glucan endo-1,3-beta-D-glucosidase activity Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.655

Rank 1 · TkA01G048980 · TK1151

Cell membrane0.104

Rank 2 · TkA01G048980 · TK1151

Endoplasmic reticulum0.090

Rank 3 · TkA01G048980 · TK1151

Cytoplasm0.088

Rank 4 · TkA01G048980 · TK1151

Lysosome / Vacuole0.065

Rank 5 · TkA01G048980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00332Glyco_hydro_1727-337 aa

PF29664BtgE-BtgC_glyc-hydro45-323 aa

PF215842L_N_poxvirus272-332 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G048980	`PF00332`	Glyco_hydro_17	27	337	1.8e-92	310.9
TkA01G048980	`PF29664`	BtgE-BtgC_glyc-hydro	45	323	3.8e-19	69.6
TkA01G048980	`PF21584`	2L_N_poxvirus	272	332	0.24	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49352`	Arabidopsis thaliana	sp\|O49352\|BG4_ARATH Probable glucan endo-1,3-beta-glucosidase BG4	45.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card