TkA01G048850 | RubberDandelionOmics

Gene overview

TkA01G048850

Reference: TK1151 Chr: Chr01 Coordinates: 12606754-12607800 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

633 bp · TkA01G048850|TK1151|cDNA

ATGGAAATGGTTGCTTCCTGGACAAAAGGCCTATGTGATGACATTTCCAAGAAAGAAGTTGAAAACCATCATGAAAATGACAATTCTGAATTCAAGAAAGATTTAGGAGCTTGGAGTGTTCTTGATGTTGGAACTGGCAATGGACTTCTCCTTCAAGAACTTTCTAAACAGGGATTCTCCGATCTAACTGGAACAGACTACAATGAAGGAGCAATTGATCTTGCTCAAAACCTTGCAAACCGTGATGGATTTGATACCAT...

CDS

Download CDS FASTA

633 bp · TkA01G048850|TK1151|CDS

ATGGAAATGGTTGCTTCCTGGACAAAAGGCCTATGTGATGACATTTCCAAGAAAGAAGTTGAAAACCATCATGAAAATGACAATTCTGAATTCAAGAAAGATTTAGGAGCTTGGAGTGTTCTTGATGTTGGAACTGGCAATGGACTTCTCCTTCAAGAACTTTCTAAACAGGGATTCTCCGATCTAACTGGAACAGACTACAATGAAGGAGCAATTGATCTTGCTCAAAACCTTGCAAACCGTGATGGATTTGATACCAT...

Protein

Download Protein FASTA

210 aa · TkA01G048850|TK1151|PROTEIN

MEMVASWTKGLCDDISKKEVENHHENDNSEFKKDLGAWSVLDVGTGNGLLLQELSKQGFSDLTGTDYNEGAIDLAQNLANRDGFDTIKFLVDDILETKFDKKFRLVTDKGTLDAIGLHPDGPIKRIMYWEYMSRLVAPGGLLVITSCNNTRDELVQEVENFNQRKALEESEISRNPPIFSYLDHIRSYPTFMFGGSVGSRVATVAFLRST

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G048850`
TK1151 ID	TkA01G048850
OH-1004 ID	LXL04_007031
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.200
Protein coverage (%)	TK1151 100.000 / OH-1004 57.453 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G048850`
Location	Chr01:12606754-12607800 (+)
Description	Similar to EEF1AKMT2: EEF1A lysine methyltransferase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007031` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006417 regulation of translation Biological Process GO:0006479 protein methylation Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0018022 peptidyl-lysine methylation Biological Process GO:0032259 methylation Biological Process GO:2000765 regulation of cytoplasmic translation Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0008168 methyltransferase activity Molecular Function GO:0016279 protein-lysine N-methyltransferase activity Molecular Function
KEGG gene cross-reference	dre:503749 hsa:399818 mmu:72096 sce:YIL064W spo:2541223 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.697

Rank 1 · TkA01G048850 · TK1151

Nucleus0.502

Rank 2 · TkA01G048850 · TK1151

Mitochondrion0.068

Rank 3 · TkA01G048850 · TK1151

Peroxisome0.052

Rank 4 · TkA01G048850 · TK1151

Cell membrane0.034

Rank 5 · TkA01G048850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13679Methyltransf_3231-119 aa

PF03848TehB33-152 aa

PF01209Ubie_methyltran34-144 aa

PF06325PrmA38-96 aa

PF13847Methyltransf_3139-163 aa

PF13489Methyltransf_2339-152 aa

PF05175MTS39-106 aa

PF07021MetW39-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G048850	`PF13679`	Methyltransf_32	31	119	0.014	16.1
TkA01G048850	`PF03848`	TehB	33	152	3.5e-05	24.0
TkA01G048850	`PF01209`	Ubie_methyltran	34	144	0.047	13.8
TkA01G048850	`PF06325`	PrmA	38	96	0.00073	19.8
TkA01G048850	`PF13847`	Methyltransf_31	39	163	2.9e-17	63.5
TkA01G048850	`PF13489`	Methyltransf_23	39	152	1.3e-08	35.5
TkA01G048850	`PF05175`	MTS	39	106	4.7e-06	27.0
TkA01G048850	`PF07021`	MetW	39	114	0.2	12.0
TkA01G048850	`PF13649`	Methyltransf_25	40	114	1.1e-11	46.0
TkA01G048850	`PF08241`	Methyltransf_11	41	144	1.4e-09	39.1
TkA01G048850	`PF08242`	Methyltransf_12	41	142	3.5e-08	34.8
TkA01G048850	`PF29244`	Methyltransf_ANTKMT	42	101	0.00062	20.9
TkA01G048850	`PF13679`	Methyltransf_32	148	166	0.014	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card