TkA01G046420 | RubberDandelionOmics

Gene overview

TkA01G046420

Reference: TK1151 Chr: Chr01 Coordinates: 12004571-12008184 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2280 bp · TkA01G046420|TK1151|cDNA

ATGTCATTTACGCCTTTTACATTGTCTATTTACGCCTTTTGGGTGGAGGTGGATGGAGCTTTACGCCTTTTGGGATTCCTACTCCCAAGCTATTTACGCCTTTTGGGTGGAGGTGGATGGAGCTTTACGCCTTTTGGGATTCCTACTCCCAAGGTCTATGCCATATACGCCTTTTCAAGTTGCTCTTTGATCCCTAGTACAGTTTTGTCTTATGGGAATATTCTAGAGCCCTATGAGGTGTCTCATTCCTATTGGTGGAA...

CDS

Download CDS FASTA

2280 bp · TkA01G046420|TK1151|CDS

ATGTCATTTACGCCTTTTACATTGTCTATTTACGCCTTTTGGGTGGAGGTGGATGGAGCTTTACGCCTTTTGGGATTCCTACTCCCAAGCTATTTACGCCTTTTGGGTGGAGGTGGATGGAGCTTTACGCCTTTTGGGATTCCTACTCCCAAGGTCTATGCCATATACGCCTTTTCAAGTTGCTCTTTGATCCCTAGTACAGTTTTGTCTTATGGGAATATTCTAGAGCCCTATGAGGTGTCTCATTCCTATTGGTGGAA...

Protein

Download Protein FASTA

759 aa · TkA01G046420|TK1151|PROTEIN

MSFTPFTLSIYAFWVEVDGALRLLGFLLPSYLRLLGGGGWSFTPFGIPTPKVYAIYAFSSCSLIPSTVLSYGNILEPYEVSHSYWWNEWGPYGKMGLAPFPSPINRRSPPSSAFANSQVFKESMFLKETSPRLFGQELQVCNFINWLRDTPKFTLPPEEVARATSETKPFIMSQEDWELIRPAGPWGSEAVTSEERCLQHRYRHDNLVNLKMRHGSSATDHINEFNSILTRLASVEIKFEDEVQALLLLSSLPESWSGTV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G046420`
TK1151 ID	TkA01G046420
OH-1004 ID	LXL04_037593
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	76.200
Protein coverage (%)	TK1151 77.997 / OH-1004 33.407 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G046420`
Location	Chr01:12004571-12008184 (-)
Description	Similar to Retrovirus-related Pol polyprotein from transposon TNT 1-94
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037593` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0071897 DNA biosynthetic process Biological Process GO:0042575 DNA polymerase complex Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.588

Rank 1 · TkA01G046420 · TK1151

Nucleus0.283

Rank 2 · TkA01G046420 · TK1151

Endoplasmic reticulum0.081

Rank 3 · TkA01G046420 · TK1151

Cell membrane0.075

Rank 4 · TkA01G046420 · TK1151

Peroxisome0.074

Rank 5 · TkA01G046420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14223Retrotran_gag_2206-290 aa

PF00098zf-CCHC342-358 aa

PF29688TnsB_C383-411 aa

PF22936Pol_BBD390-468 aa

PF13976gag_pre-integrs496-559 aa

PF00098zf-CCHC522-527 aa

PF00665rve610-656 aa

PF29688TnsB_C620-674 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G046420	`PF14223`	Retrotran_gag_2	206	290	4.6e-11	43.5
TkA01G046420	`PF00098`	zf-CCHC	342	358	0.00035	21.3
TkA01G046420	`PF29688`	TnsB_C	383	411	3.8e-05	24.2
TkA01G046420	`PF22936`	Pol_BBD	390	468	6.9e-22	78.3
TkA01G046420	`PF13976`	gag_pre-integrs	496	559	1.8e-16	60.4
TkA01G046420	`PF00098`	zf-CCHC	522	527	0.00035	21.3
TkA01G046420	`PF00665`	rve	610	656	0.024	15.6
TkA01G046420	`PF29688`	TnsB_C	620	674	3.8e-05	24.2
TkA01G046420	`PF13683`	rve_3	645	678	0.0012	19.3
TkA01G046420	`PF25597`	SH3_retrovirus	730	758	3.6e-06	27.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card