TkA01G044660 | RubberDandelionOmics

Gene overview

TkA01G044660

Reference: TK1151 Chr: Chr01 Coordinates: 11541789-11542304 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · TkA01G044660|TK1151|cDNA

ATGGCATCAAAGTGCGGTGTTTCAGTATATCTTTATCTTGCTAATACTCTTTTATTGTTTGGCATAGTTACTGGTTGTGAGATATCAACTAATCCTACCCCCACACCAAATCCCAACAACAACTACAACCCCAACCCCACCACCACCTCCTACCCCACGCCTACCTCTAACCCCACCCTACCCAAACTCCACGCCAACTCCGTCCCCATTCCAAATTCCAATGAAAACTCAAACCAAAAACCCAACATCGGCACCTGCCC...

CDS

Download CDS FASTA

429 bp · TkA01G044660|TK1151|CDS

ATGGCATCAAAGTGCGGTGTTTCAGTATATCTTTATCTTGCTAATACTCTTTTATTGTTTGGCATAGTTACTGGTTGTGAGATATCAACTAATCCTACCCCCACACCAAATCCCAACAACAACTACAACCCCAACCCCACCACCACCTCCTACCCCACGCCTACCTCTAACCCCACCCTACCCAAACTCCACGCCAACTCCGTCCCCATTCCAAATTCCAATGAAAACTCAAACCAAAAACCCAACATCGGCACCTGCCC...

Protein

Download Protein FASTA

142 aa · TkA01G044660|TK1151|PROTEIN

MASKCGVSVYLYLANTLLLFGIVTGCEISTNPTPTPNPNNNYNPNPTTTSYPTPTSNPTLPKLHANSVPIPNSNENSNQKPNIGTCPRDTLRLGVCAKLLGGLVSLEVGSPPVKPCCSLIQGLVDLEAAVCLCTAFKANVLE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G044660`
TK1151 ID	TkA01G044660
OH-1004 ID	LXL04_005472
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	62.300
Protein coverage (%)	TK1151 99.296 / OH-1004 85.492 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G044660

Location Chr01:11541789-11542304 (+)

Description Similar to EARLI1: Lipid transfer protein EARLI 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12500`	Probable lipid transfer protein (LTP).	No verified direct reference in this release
`At4g12490`	Probable lipid transfer protein (LTP).	Influence of EARLI1-like genes on flowering time and lignin synthesis of Arabidopsis thaliana.2011 · DOI: 10.1111/j.1438-8677.2010.00428.x
`At4g12480`	Probable lipid transfer protein (LTP).	Cold responsive EARLI1 type HyPRPs improve freezing survival of yeast cells and form higher order complexes in plants.2007 · DOI: 10.1007/s00425-007-0611-2 The HyPRP gene EARLI1 has an auxiliary role for germinability and early seedling development under low temperature and salt stress conditions in Arabidopsis thaliana.2011 · DOI: 10.1007/s00425-011-1425-9 Influence of EARLI1-like genes on flowering time and lignin synthesis of Arabidopsis thaliana.2011 · DOI: 10.1111/j.1438-8677.2010.00428.x Expression of recombinant EARLI1, a hybrid proline-rich protein of Arabidopsis, in Escherichia coli and its inhibition effect to the growth of fungal pathogens and Saccharomyces cerevisiae.2012 · DOI: 10.1016/j.gene.2012.06.070
`At4g12550`	Putative lipid-binding protein AIR1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005472 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT4G12470

ath:AT4G12480

ath:AT4G12490

ath:AT4G12500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.584

Rank 1 · TkA01G044660 · TK1151

Endoplasmic reticulum0.156

Rank 2 · TkA01G044660 · TK1151

Cytoplasm0.103

Rank 3 · TkA01G044660 · TK1151

Cell membrane0.081

Rank 4 · TkA01G044660 · TK1151

Lysosome / Vacuole0.061

Rank 5 · TkA01G044660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00234Tryp_alpha_amyl2-9 aa

PF13136DUF398439-79 aa

PF14547Hydrophob_seed85-141 aa

PF00234Tryp_alpha_amyl86-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G044660	`PF00234`	Tryp_alpha_amyl	2	9	6.6e-09	36.6
TkA01G044660	`PF13136`	DUF3984	39	79	4.9	7.1
TkA01G044660	`PF14547`	Hydrophob_seed	85	141	1.8e-16	61.0
TkA01G044660	`PF00234`	Tryp_alpha_amyl	86	141	6.6e-09	36.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU33`	Arabidopsis thaliana	sp\|Q9SU33\|ERLL3_ARATH pEARLI1-like lipid transfer protein 3	67.200%	Swiss-Prot	Low
`Q9SU34`	Arabidopsis thaliana	sp\|Q9SU34\|ERLL2_ARATH pEARLI1-like lipid transfer protein 2	69.000%	Swiss-Prot	Low
`Q39176`	Arabidopsis thaliana	sp\|Q39176\|ERLI1_ARATH Lipid transfer protein EARLI 1	50.400%	Swiss-Prot	High
`Q9S7I2`	Arabidopsis thaliana	sp\|Q9S7I2\|AIR1_ARATH Putative lipid-binding protein AIR1	65.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card