TkA01G040600 | RubberDandelionOmics

Gene overview

TkA01G040600

Reference: TK1151 Chr: Chr01 Coordinates: 10454835-10455443 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

609 bp · TkA01G040600|TK1151|cDNA

ATGTCCCAACGAAATCAAAAAGTAATGACCGACGACGATCAAGAGAAACCTTTATCTCCGGCGCCGGAGACCCATCATCCACCCACCGCCGTCGACGAAGCTTTATCAACCAAACCCAGTAAGCAACTGCAACGCCATGGCTTCCACAAACGCACAATCTGCTGCGGTATCATCACTGCCGTTATACTCATCGTCGCGGTGGTGCTGCTAATCCTAGGCCTCACAGTCCTCCGCGTTAAAGAACCTGAAATCAATATGAA...

CDS

Download CDS FASTA

609 bp · TkA01G040600|TK1151|CDS

ATGTCCCAACGAAATCAAAAAGTAATGACCGACGACGATCAAGAGAAACCTTTATCTCCGGCGCCGGAGACCCATCATCCACCCACCGCCGTCGACGAAGCTTTATCAACCAAACCCAGTAAGCAACTGCAACGCCATGGCTTCCACAAACGCACAATCTGCTGCGGTATCATCACTGCCGTTATACTCATCGTCGCGGTGGTGCTGCTAATCCTAGGCCTCACAGTCCTCCGCGTTAAAGAACCTGAAATCAATATGAA...

Protein

Download Protein FASTA

202 aa · TkA01G040600|TK1151|PROTEIN

MSQRNQKVMTDDDQEKPLSPAPETHHPPTAVDEALSTKPSKQLQRHGFHKRTICCGIITAVILIVAVVLLILGLTVLRVKEPEINMNSVAIIGLDRVNVADLLSGKANLTVVADVSVKNTNVAAFRFKRSNSSLVYHETVVGVADVPGGVAKARRTMRLNLTFEVMATEIVGNRQFGSDLLSGYFRWQVIQRLTAGLKYSTS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G040600`
TK1151 ID	TkA01G040600
OH-1004 ID	LXL04_005510
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	53.300
Protein coverage (%)	TK1151 98.020 / OH-1004 84.211 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G040600`
Location	Chr01:10454835-10455443 (+)
Description	Similar to At1g64065: Late embryogenesis abundant protein At1g64065
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005510` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0098542 defense response to other organism Biological Process GO:0005634 nucleus Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	ath:AT1G64065 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.642

Rank 1 · TkA01G040600 · TK1151

Endoplasmic reticulum0.144

Rank 2 · TkA01G040600 · TK1151

Lysosome / Vacuole0.123

Rank 3 · TkA01G040600 · TK1151

Cytoplasm0.122

Rank 4 · TkA01G040600 · TK1151

Nucleus0.063

Rank 5 · TkA01G040600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21181SsfX3_N17-40 aa

PF14927Neurensin42-79 aa

PF03168LEA_2115-175 aa

PF21181SsfX3_N115-169 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G040600	`PF21181`	SsfX3_N	17	40	0.089	13.7
TkA01G040600	`PF14927`	Neurensin	42	79	0.16	12.4
TkA01G040600	`PF03168`	LEA_2	115	175	0.0006	21.0
TkA01G040600	`PF21181`	SsfX3_N	115	169	0.089	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card