RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G035440
Reference: TK1151 Chr: Chr01 Coordinates: 9213773-9214297 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

525 bp · TkA01G035440|TK1151|cDNA

ATCTCTTCCCTCAAAATTATAATCCATAATGGGATTTCCAGTTGGATACACCGACCTCTTCCTCCCCAAACTCCTCCCCACATCCTAACCGTTCTGGGTTTCATCCGAAAGCTCATTTCCTTCGTTTTCCGATTTGTTGGCCTCGGAGAGTTTCTCGAACCCGATTTCTCATCGGACCCGACCCGGAACGAACCGGTGATGCAGTTCCATTCCGTTTCTGCGGTCCTCATCCGTGAGCTTCTCCCGGTGGTGAAGTTCTC...

CDS

Download CDS FASTA

525 bp · TkA01G035440|TK1151|CDS

ATCTCTTCCCTCAAAATTATAATCCATAATGGGATTTCCAGTTGGATACACCGACCTCTTCCTCCCCAAACTCCTCCCCACATCCTAACCGTTCTGGGTTTCATCCGAAAGCTCATTTCCTTCGTTTTCCGATTTGTTGGCCTCGGAGAGTTTCTCGAACCCGATTTCTCATCGGACCCGACCCGGAACGAACCGGTGATGCAGTTCCATTCCGTTTCTGCGGTCCTCATCCGTGAGCTTCTCCCGGTGGTGAAGTTCTC...

Protein

Download Protein FASTA

174 aa · TkA01G035440|TK1151|PROTEIN

ISSLKIIIHNGISSWIHRPLPPQTPPHILTVLGFIRKLISFVFRFVGLGEFLEPDFSSDPTRNEPVMQFHSVSAVLIRELLPVVKFSELVDPPESCAVCLYEFDAGDEIRRLTNCRHIFHRCCLDRWMDHDQKTCPLCRTPFIPDDLQDSFNERLWAASGIADYYGDSSLVSGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G035440
TK1151 IDTkA01G035440
OH-1004 IDLXL04_005546
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)97.300
Protein coverage (%)TK1151 85.632 / OH-1004 89.759
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G035440
LocationChr01:9213773-9214297 (+)
DescriptionSimilar to BRH1: Brassinosteroid-responsive RING protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g61460 May be involved in the brassinosteroids (BRs) signaling pathway and regulate the growth and development of rosette leaves.
Characterisation of BRH1, a brassinosteroid-responsive RING-H2 gene from Arabidopsis thaliana.2002 · DOI: 10.1007/s00425-001-0723-z
Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.2018 · DOI: 10.1007/s11427-017-9133-8
At4g11360 Possesses E3 ubiquitin-protein ligase activity when associated with the E2 enzyme UBC8 in vitro. No verified direct reference in this release
At2g04240 Function on abscisic acid homeostasis at post-translational level, probably through ubiquitin/proteasome-dependent substrate- specific degradation.
Upregulation of an Arabidopsis RING-H2 gene, XERICO, confers drought tolerance through increased abscisic acid biosynthesis.2006 · DOI: 10.1111/j.1365-313x.2006.02782.x
Global analysis of della direct targets in early gibberellin signaling in Arabidopsis.2007 · DOI: 10.1105/tpc.107.054999
At2g01150 E3 ubiquitin-protein ligase involved in the positive regulation of abscisic acid (ABA) signaling and responses to salt and osmotic stresses during seed germination and early seedling development.
The Arabidopsis RING finger E3 ligase RHA2b acts additively with RHA2a in regulating abscisic acid signaling and drought response.2011 · DOI: 10.1104/pp.111.176214
At1g15100 E3 ubiquitin-protein ligase involved in the positive regulation of abscisic acid (ABA) signaling and responses to salt and osmotic stresses during seed germination and early seedling development.
The Arabidopsis RING finger E3 ligase RHA2a is a novel positive regulator of abscisic acid signaling during seed germination and early seedling development.2009 · DOI: 10.1104/pp.109.135269
The Arabidopsis RING finger E3 ligase RHA2b acts additively with RHA2a in regulating abscisic acid signaling and drought response.2011 · DOI: 10.1104/pp.111.176214

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_005546 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009741 response to brassinosteroid Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process
GO:0010200 response to chitin Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0047484 regulation of response to osmotic stress Biological Process
GO:0071456 cellular response to hypoxia Biological Process
GO:1901371 regulation of leaf morphogenesis Biological Process
GO:1905421 regulation of plant organ morphogenesis Biological Process
GO:0005634 nucleus Cellular Component
KEGG gene cross-reference
ath:AT2G01150
ath:AT3G61460
ath:AT4G11360
ath:AT4G11370
spo:2541304
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.393
Rank 1 · TkA01G035440 · TK1151
Nucleus0.326
Rank 2 · TkA01G035440 · TK1151
Endoplasmic reticulum0.173
Rank 3 · TkA01G035440 · TK1151
Golgi apparatus0.131
Rank 4 · TkA01G035440 · TK1151
Cell membrane0.130
Rank 5 · TkA01G035440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04423Rad50_zn_hook88-113 aa
PF27618Zn_ribbon_GTF2H291-105 aa
PF21349RUBY_RBDX91-99 aa
PF12660zf-TFIIIC94-148 aa
PF13639zf-RING_295-139 aa
PF17120zf-RING_1695-136 aa
PF14446Prok-RING_195-126 aa
PF13920zf-C3HC4_395-141 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G035440PF04423Rad50_zn_hook881130.05414.0
TkA01G035440PF27618Zn_ribbon_GTF2H2911050.0513.9
TkA01G035440PF21349RUBY_RBDX91990.6310.3
TkA01G035440PF12660zf-TFIIIC941480.03814.8
TkA01G035440PF13639zf-RING_2951394.7e-1349.9
TkA01G035440PF17120zf-RING_16951360.001319.0
TkA01G035440PF14446Prok-RING_1951260.02115.7
TkA01G035440PF13920zf-C3HC4_3951410.05813.9
TkA01G035440PF17123zf-RING_11961245.1e-0730.0
TkA01G035440PF00097zf-C3HC4961381.4e-0628.8
TkA01G035440PF13923zf-C3HC4_2961382.4e-0627.9
TkA01G035440PF14634zf-RING_5961407.6e-0626.5
TkA01G035440PF13445zf-RING_UBOX961361.9e-0525.3
TkA01G035440PF14570zf-RING_4961420.01815.5
TkA01G035440PF14447Prok-RING_4961400.4311.2
TkA01G035440PF12906RINGv961381.49.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9XF92Arabidopsis thalianasp|Q9XF92|BRH1_ARATH Brassinosteroid-responsive RING protein 158.800%Swiss-ProtHigh
Q9SUS5Arabidopsis thalianasp|Q9SUS5|RHA1B_ARATH E3 ubiquitin-protein ligase RHA1B38.700%Swiss-ProtMedium
Q9SI09Arabidopsis thalianasp|Q9SI09|XERIC_ARATH Probable E3 ubiquitin-protein ligase XERICO40.700%Swiss-ProtLow
Q9ZU51Arabidopsis thalianasp|Q9ZU51|RHA2B_ARATH E3 ubiquitin-protein ligase RHA2B49.000%Swiss-ProtLow
Q9ZT50Arabidopsis thalianasp|Q9ZT50|RHA2A_ARATH E3 ubiquitin-protein ligase RHA2A47.100%Swiss-ProtLow

JBrowse

View in Genome Browser