TkA01G034480 | RubberDandelionOmics

Gene overview

TkA01G034480

Reference: TK1151 Chr: Chr01 Coordinates: 8987585-8988526 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

885 bp · TkA01G034480|TK1151|cDNA

ATGTTCATGAAAATAAAAACAAAACTCAAACCAAATTCCAGCACTTACAACATCTTGTTCTTCGGTTGGTGTAGAGTCAGAAACCCTAAAAAAAGCATGCAAATCCTCGATGAAATGATCCAAGTGGGCCACACCCCTGAAAACTTCACCTACAACACTGCCATTGACACATTTTGCAAGTCCGGGATGCTTCCGGAAGCTTCCGAGCTTCTAAACCACATGAAATCAAAAGGCACACACATGTCTTCCCCCACAGCCAA...

CDS

Download CDS FASTA

885 bp · TkA01G034480|TK1151|CDS

ATGTTCATGAAAATAAAAACAAAACTCAAACCAAATTCCAGCACTTACAACATCTTGTTCTTCGGTTGGTGTAGAGTCAGAAACCCTAAAAAAAGCATGCAAATCCTCGATGAAATGATCCAAGTGGGCCACACCCCTGAAAACTTCACCTACAACACTGCCATTGACACATTTTGCAAGTCCGGGATGCTTCCGGAAGCTTCCGAGCTTCTAAACCACATGAAATCAAAAGGCACACACATGTCTTCCCCCACAGCCAA...

Protein

Download Protein FASTA

294 aa · TkA01G034480|TK1151|PROTEIN

MFMKIKTKLKPNSSTYNILFFGWCRVRNPKKSMQILDEMIQVGHTPENFTYNTAIDTFCKSGMLPEASELLNHMKSKGTHMSSPTAKTYSIMIVAFARENKMDECFKLIDDMASSGILPDVSTYREIIQGMCFNKNIEFGYKFLQHMENKGYPSDIVTYNSFLKVLCDNNNSKEAVTLFKKMSEVNDPIGAFGIWREMDNRRCVRDTESYCVMIEGLFGCEMVNDACGLLEEVLNKDMKLPYQKFDCFLMELSRVGDLRA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G034480`
TK1151 ID	TkA01G034480
OH-1004 ID	LXL04_005553
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	76.000
Protein coverage (%)	TK1151 100.000 / OH-1004 51.144 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G034480

Location Chr01:8987585-8988526 (+)

Description Similar to At1g73400: Pentatricopeptide repeat-containing protein At1g73400, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73400`	Pentatricopeptide repeat-containing protein At1g73400, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005553 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G73400

ath:AT1G77360

ath:AT3G62470

ath:AT3G62540

ath:AT5G14820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.795

Rank 1 · TkA01G034480 · TK1151

Plastid0.101

Rank 2 · TkA01G034480 · TK1151

Nucleus0.067

Rank 3 · TkA01G034480 · TK1151

Cytoplasm0.029

Rank 4 · TkA01G034480 · TK1151

Cell membrane0.011

Rank 5 · TkA01G034480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12854PPR_19-39 aa

PF13812PPR_39-58 aa

PF17177PPR_long10-80 aa

PF13041PPR_211-60 aa

PF29070MSC6_N12-108 aa

PF01535PPR14-43 aa

PF12921ATP1320-41 aa

PF10037MRP-S2725-71 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G034480	`PF12854`	PPR_1	9	39	5.5e-41	138.7
TkA01G034480	`PF13812`	PPR_3	9	58	3e-20	72.8
TkA01G034480	`PF17177`	PPR_long	10	80	7.9e-12	45.7
TkA01G034480	`PF13041`	PPR_2	11	60	4.6e-48	161.8
TkA01G034480	`PF29070`	MSC6_N	12	108	5.6e-07	29.7
TkA01G034480	`PF01535`	PPR	14	43	6.2e-34	114.6
TkA01G034480	`PF12921`	ATP13	20	41	0.0054	17.3
TkA01G034480	`PF10037`	MRP-S27	25	71	0.017	14.8
TkA01G034480	`PF23276`	TPR_24	29	87	2.8e-15	57.1
TkA01G034480	`PF24760`	TPR_IF140_C	29	75	0.0013	19.8
TkA01G034480	`PF06239`	ECSIT_N	33	60	0.0076	16.3
TkA01G034480	`PF12854`	PPR_1	43	75	5.5e-41	138.7
TkA01G034480	`PF13041`	PPR_2	47	98	4.6e-48	161.8
TkA01G034480	`PF01535`	PPR	49	78	6.2e-34	114.6
TkA01G034480	`PF13812`	PPR_3	50	96	3e-20	72.8
TkA01G034480	`PF24480`	TPGS1_C	50	75	0.13	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FX35`	Arabidopsis thaliana	sp\|Q9FX35\|PP117_ARATH Pentatricopeptide repeat-containing protein At1g73400, mitochondrial	49.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card