TkA01G033130 | RubberDandelionOmics

Gene overview

TkA01G033130

Reference: TK1151 Chr: Chr01 Coordinates: 8606383-8609848 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1086 bp · TkA01G033130|TK1151|cDNA

ATGCGTAGGTTCTATCTAGGTTGCATGCTAGATAGTGATGTGAGTAGTTTGAGAGATGCGTTGGGTAAAAAAGACGAGGAGATGGGGCGGTTACGGGGCGGAACGACGAATGGGAGGGCTCCACATGGCGGTGGATTAGAGGTTAGTGAAACGGGGTCTGAGAGGTCGGGCGATGAGGTGGAGGATATCGAGATGTTGGGGTTGTTGGGTGAAGATGATTCGGAAGAGAGACTAAGTGATATTTCAGATGGTGGTCTTTC...

CDS

Download CDS FASTA

1086 bp · TkA01G033130|TK1151|CDS

ATGCGTAGGTTCTATCTAGGTTGCATGCTAGATAGTGATGTGAGTAGTTTGAGAGATGCGTTGGGTAAAAAAGACGAGGAGATGGGGCGGTTACGGGGCGGAACGACGAATGGGAGGGCTCCACATGGCGGTGGATTAGAGGTTAGTGAAACGGGGTCTGAGAGGTCGGGCGATGAGGTGGAGGATATCGAGATGTTGGGGTTGTTGGGTGAAGATGATTCGGAAGAGAGACTAAGTGATATTTCAGATGGTGGTCTTTC...

Protein

Download Protein FASTA

361 aa · TkA01G033130|TK1151|PROTEIN

MRRFYLGCMLDSDVSSLRDALGKKDEEMGRLRGGTTNGRAPHGGGLEVSETGSERSGDEVEDIEMLGLLGEDDSEERLSDISDGGLSMTDGSLGSSIIELTLFPRTVKPPEKLNVPSKLPRPPQKTVAAAAATSSRRPVQTTPSSSASFLNSQRVPTPSRTSLAKGVPRVSLGSSGKKSTPGCTWVKIDDDSNVSSLRDALGKKDEEMVQLRGGTTNGRAPHGGGLEVSETGSERSGDDVEDTEMLGLLGEDDSEERLSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G033130`
TK1151 ID	TkA01G033130
OH-1004 ID	LXL04_005570
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.500
Protein coverage (%)	TK1151 46.537 / OH-1004 9.086 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G033130`
Location	Chr01:8606383-8609848 (-)
Description	Similar to KIN14K: Kinesin-like protein KIN-14K
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005570` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007017 microtubule-based process Biological Process GO:0007018 microtubule-based movement Biological Process GO:0098542 defense response to other organism Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005874 microtubule Cellular Component GO:0015630 microtubule cytoskeleton Cellular Component GO:0003777 microtubule motor activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0008017 microtubule binding Molecular Function GO:0043531 ADP binding Molecular Function
KEGG gene cross-reference	ath:AT1G63640 ath:AT3G14470 ath:AT5G41310 dosa:Os01g0744000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.660

Rank 1 · TkA01G033130 · TK1151

Nucleus0.353

Rank 2 · TkA01G033130 · TK1151

Cell membrane0.054

Rank 3 · TkA01G033130 · TK1151

Mitochondrion0.049

Rank 4 · TkA01G033130 · TK1151

Endoplasmic reticulum0.037

Rank 5 · TkA01G033130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30869GMNC_CC15-32 aa

PF11874DUF339438-81 aa

PF30869GMNC_CC195-212 aa

PF11874DUF3394216-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G033130	`PF30869`	GMNC_CC	15	32	0.36	11.4
TkA01G033130	`PF11874`	DUF3394	38	81	0.076	13.4
TkA01G033130	`PF30869`	GMNC_CC	195	212	0.36	11.4
TkA01G033130	`PF11874`	DUF3394	216	269	0.076	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card