TkA01G030810 | RubberDandelionOmics

Gene overview

TkA01G030810

Reference: TK1151 Chr: Chr01 Coordinates: 7921272-7926184 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1818 bp · TkA01G030810|TK1151|cDNA

ATGAAGGTGTATGTGGACCAGTATAATGAGCCAATCTTCGACTGGATTGAGGCGGATGATGGAGAAGAGGAAGGTAGTGAAGATCTTGACTGTGAGGAAGATGAAGATTCCGTGTTTTCTGATCCAGAATCTGTTGATCATGAAGAAGATGGTGAATTGGATGCCAACAATCACACAACAACCGATCAATTCTTAAACATCTTGTGTCCATCAGCCCCTCTCAATGAAGATAAGCATGATGATCTACCTCAATACCCCAT...

CDS

Download CDS FASTA

3171 bp · TkA01G030810|TK1151|CDS

ATGGCTCTTCTCCTATCGCTTAAACTACCATCCACGTCACCATCACCGTTACCGCCACAATCACCACCGCCCCTCCTTCTTTCTCCGCTTACCTCCTCCTTATTCCCCCACACAATCAAACCCTCCAAATCCAATCACCACCGCCAAACCCGCTTCTCCTACAGCAATCGAGACCCGCCGGATCCAGGCTGCCCCGTCCCACCAGAGCAACAACCCATCAACGAGTACCAATCTCTCTCCACTTCCTCCCCTTTCTCCTG...

Protein

Download Protein FASTA

1056 aa · TkA01G030810|TK1151|PROTEIN

MALLLSLKLPSTSPSPLPPQSPPPLLLSPLTSSLFPHTIKPSKSNHHRQTRFSYSNRDPPDPGCPVPPEQQPINEYQSLSTSSPFSWASGDFVEYCSRLLVTGVGFAMFVGLPVSWYGSVGVGWEPVQRILGAVCSGIFATTLAVVRMYLGWAYVGNRLLSATVEYEETGWYDGQIWVKTAEVLARDRLLGSFTVKPVLSRLKNTLVALALSLFVFIVLLVNTESQKVAASMASGGEPGGRAVVGSYNDESARSFEPEAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G030810`
TK1151 ID	TkA01G030810
OH-1004 ID	LXL04_011904
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.600
Protein coverage (%)	TK1151 68.845 / OH-1004 86.962 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G030810

Location Chr01:7921272-7926184 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67370`	Required for growth in low iron conditions.	Systems and trans-system level analysis identifies conserved iron deficiency responses in the plant lineage.2012 · DOI: 10.1105/tpc.112.102491

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011904 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.546

Rank 1 · TkA01G030810 · TK1151

Nucleus0.286

Rank 2 · TkA01G030810 · TK1151

Mitochondrion0.082

Rank 3 · TkA01G030810 · TK1151

Cytoplasm0.035

Rank 4 · TkA01G030810 · TK1151

Cell membrane0.029

Rank 5 · TkA01G030810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06799CGLD27-like64-207 aa

PF26130PB1-like279-376 aa

PF03108DBD_Tnp_Mut471-536 aa

PF10551MULE670-766 aa

PF00872Transposase_mut685-776 aa

PF26130PB1-like877-908 aa

PF04434SWIM921-946 aa

PF16588zf-C2H2_101027-1044 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G030810	`PF06799`	CGLD27-like	64	207	2e-52	177.8
TkA01G030810	`PF26130`	PB1-like	279	376	2.1e-06	28.6
TkA01G030810	`PF03108`	DBD_Tnp_Mut	471	536	1.8e-08	34.6
TkA01G030810	`PF10551`	MULE	670	766	1.1e-15	58.5
TkA01G030810	`PF00872`	Transposase_mut	685	776	8.4e-07	28.9
TkA01G030810	`PF26130`	PB1-like	877	908	2.1e-06	28.6
TkA01G030810	`PF04434`	SWIM	921	946	1.2e-07	31.8
TkA01G030810	`PF16588`	zf-C2H2_10	1027	1044	0.94	10.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN15`	Arabidopsis thaliana	sp\|Q9FN15\|GLD27_ARATH Protein CONSERVED IN THE GREEN LINEAGE AND DIATOMS 27, chloroplastic	48.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card