Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3487 bp · TkA01G028130|TK1151|cDNA
GGAAAAAGGTAAACTTTAATGGCACAGCCGTATATAACATTCATCTACAAGTCCTTTTCTTTTAATTACACCTACAAAAACCCCGCCGCCTCACCTATATGTCTAAAAGTCGGCTTCGGATTTTCAACACAAGAAACAAATATTGTAAAAATTTCCCGGCAACATAAGCCACAACCGCCGCCGGCGATTTACCGGAAAATGGCGAGATGGCAACCGGCATTATCACTACCAAAACCTCTACACACTCTCTTCTTCTTCCT...
450 bp · TkA01G028130|TK1151|CDS
ATGGAAACTGACATCATTCATAAATTGGAGTTCACGGAAGCAAACATTTTGTGTTGTTTGACCGAGAACAACCTAATAGGTAGTGGTGGATCCGGGAAAGTGTACCAGATTGAGATTGGTCGGCCTGGGGAGTATGGCAGTCAAGAGGATTTGGAACCTAGAAAACTCGATCATATTCTCGAGAAAGAGTTTTTATCAGAAGTTCATATATTGGGGTCAATTCGTCATTCCAACATAGTAAAATTACTATTTGTATTTCG...
Protein
Download Protein FASTA149 aa · TkA01G028130|TK1151|PROTEIN
METDIIHKLEFTEANILCCLTENNLIGSGGSGKVYQIEIGRPGEYGSQEDLEPRKLDHILEKEFLSEVHILGSIRHSNIVKLLFVFRARILSFLFMSTWRIKVLTSGYMGTRGIPMWVGLAHEAKSPLERLKGYAICTMIVLRRSFIEM
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G028130 |
|---|---|
| TK1151 ID | TkA01G028130 |
| OH-1004 ID | LXL04_005645 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 59.300 |
| Protein coverage (%) | TK1151 75.168 / OH-1004 10.373Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G028130 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:7210066-7214131 (+) | |||||||||
| Description | Similar to HSL1: Receptor-like protein kinase HSL1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006468 protein phosphorylation Biological Process GO:0006952 defense response Biological Process GO:0010067 procambium histogenesis Biological Process GO:0010087 phloem or xylem histogenesis Biological Process GO:0010102 lateral root morphogenesis Biological Process GO:0010183 pollen tube guidance Biological Process GO:0010227 floral organ abscission Biological Process GO:0010468 regulation of gene expression Biological Process GO:0030154 cell differentiation Biological Process GO:0045490 pectin catabolic process Biological Process GO:0046777 protein autophosphorylation Biological Process GO:0050829 defense response to Gram-negative bacterium Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G28440 ath:AT4G28490 ath:AT4G28650 ath:AT5G65710 mtr:11439632 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00069Pkinase22-97 aaPF07714PK_Tyr_Ser-Thr23-87 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G028130 | PF00069 | Pkinase | 22 | 97 | 1.1e-05 | 25.7 |
| TkA01G028130 | PF07714 | PK_Tyr_Ser-Thr | 23 | 87 | 0.017 | 15.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.