TkA01G027220 | RubberDandelionOmics

Gene overview

TkA01G027220

Reference: TK1151 Chr: Chr01 Coordinates: 7020279-7021244 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

903 bp · TkA01G027220|TK1151|cDNA

ATGGCGACATCCACCACCGATGAAATCCTCTCAGAACCCCTCAATTTGATTCGTATTTTCAAAGACGGACGATTCGAGAGACTTTCAATTCCCAATATTGTTCCCGCCGGCATCGACCATTCCACCGGCGTCAACTCCAAAGACGTCGTCTTTTCACCGGAACCCAACACCTTCGCCAGACTCTACATTCCAAAAACCGCAACCCCCAACCATAAACTCCCACTTCTAATCTTCTACCACGGCGGCGAATCCAACGTCGT...

CDS

Download CDS FASTA

903 bp · TkA01G027220|TK1151|CDS

ATGGCGACATCCACCACCGATGAAATCCTCTCAGAACCCCTCAATTTGATTCGTATTTTCAAAGACGGACGATTCGAGAGACTTTCAATTCCCAATATTGTTCCCGCCGGCATCGACCATTCCACCGGCGTCAACTCCAAAGACGTCGTCTTTTCACCGGAACCCAACACCTTCGCCAGACTCTACATTCCAAAAACCGCAACCCCCAACCATAAACTCCCACTTCTAATCTTCTACCACGGCGGCGAATCCAACGTCGT...

Protein

Download Protein FASTA

300 aa · TkA01G027220|TK1151|PROTEIN

MATSTTDEILSEPLNLIRIFKDGRFERLSIPNIVPAGIDHSTGVNSKDVVFSPEPNTFARLYIPKTATPNHKLPLLIFYHGGESNVVAVSVNYRLAPEFRLPVAYDDSWEAIKWVAEHVNEKGPEPWLNEYADLQKIFVGGDSAGGNISHHMAIRFGSDSPAGLRFMGAILLHPYFWGSERVGTEPDWMTPKLIGELNDLWLSAVTNPGSVGLDDPFINPGMDPKLADLGCSKILFCISGDDFMRERVRSYKNLIEKSGW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G027220`
TK1151 ID	TkA01G027220
OH-1004 ID	LXL04_038380
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	50.600
Protein coverage (%)	TK1151 98.000 / OH-1004 98.387 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G027220

Location Chr01:7020279-7021244 (-)

Description Similar to CXE2: Probable carboxylesterase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49650`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At1g49660`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At2g03550`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At1g47480`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At1g19190`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038380 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016787 hydrolase activity Molecular Function

GO:0016829 lyase activity Molecular Function

GO:0106435 carboxylesterase activity Molecular Function

KEGG gene cross-reference

ag:BAM20978

ath:AT1G47480

ath:AT2G03550

ath:AT3G48690

ath:AT3G48700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.867

Rank 1 · TkA01G027220 · TK1151

Nucleus0.340

Rank 2 · TkA01G027220 · TK1151

Endoplasmic reticulum0.053

Rank 3 · TkA01G027220 · TK1151

Cell membrane0.032

Rank 4 · TkA01G027220 · TK1151

Mitochondrion0.029

Rank 5 · TkA01G027220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10340Say1_Mug18059-83 aa

PF20434BD-FAE61-82 aa

PF12146Hydrolase_469-92 aa

PF07859Abhydrolase_383-277 aa

PF00135COesterase84-149 aa

PF20434BD-FAE86-154 aa

PF19969VMAP-M893-121 aa

PF10340Say1_Mug180132-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G027220	`PF10340`	Say1_Mug180	59	83	0.093	12.3
TkA01G027220	`PF20434`	BD-FAE	61	82	9.6e-06	26.0
TkA01G027220	`PF12146`	Hydrolase_4	69	92	0.052	13.6
TkA01G027220	`PF07859`	Abhydrolase_3	83	277	3.4e-35	122.4
TkA01G027220	`PF00135`	COesterase	84	149	0.67	9.6
TkA01G027220	`PF20434`	BD-FAE	86	154	9.6e-06	26.0
TkA01G027220	`PF19969`	VMAP-M8	93	121	0.054	14.7
TkA01G027220	`PF10340`	Say1_Mug180	132	148	0.093	12.3
TkA01G027220	`PF12146`	Hydrolase_4	134	186	0.052	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FX93`	Arabidopsis thaliana	sp\|Q9FX93\|CXE4_ARATH Probable carboxylesterase 4, mitochondrial	39.000%	Swiss-Prot	Medium
`Q9FX94`	Arabidopsis thaliana	sp\|Q9FX94\|CXE5_ARATH Probable carboxylesterase 5	40.200%	Swiss-Prot	Medium
`Q9ZQ91`	Arabidopsis thaliana	sp\|Q9ZQ91\|CXE7_ARATH Probable carboxylesterase 7	39.000%	Swiss-Prot	Medium
`Q9SX78`	Arabidopsis thaliana	sp\|Q9SX78\|CXE2_ARATH Probable carboxylesterase 2	38.400%	Swiss-Prot	Medium
`Q9LMA7`	Arabidopsis thaliana	sp\|Q9LMA7\|CXE1_ARATH Probable carboxylesterase 1	38.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card