TkA01G022200 | RubberDandelionOmics

Gene overview

TkA01G022200

Reference: TK1151 Chr: Chr01 Coordinates: 5688896-5693063 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2073 bp · TkA01G022200|TK1151|cDNA

ATGGCATGTGATATTCTAGGTTTAACCGGTGATGACAAAGAATGGTTGCACGCCTTCAAAGATGCAGCTGTGTGGGCATCCGCATCGCAACTACGTACACTTTTTTGTCATTTGCTATCTATAGGAAAAATAGTCCTAGCTGTTGCTGGTTCAGGCATTGCATCTCTGCTCTTGCCATCCGGCAGAACTGCACACTCGCGCTTCAATATCCCTCTTCATGTTTCCAATTCTTCTATGTGCAACATCAAAAAAGGCACCCA...

CDS

Download CDS FASTA

2073 bp · TkA01G022200|TK1151|CDS

ATGGCATGTGATATTCTAGGTTTAACCGGTGATGACAAAGAATGGTTGCACGCCTTCAAAGATGCAGCTGTGTGGGCATCCGCATCGCAACTACGTACACTTTTTTGTCATTTGCTATCTATAGGAAAAATAGTCCTAGCTGTTGCTGGTTCAGGCATTGCATCTCTGCTCTTGCCATCCGGCAGAACTGCACACTCGCGCTTCAATATCCCTCTTCATGTTTCCAATTCTTCTATGTGCAACATCAAAAAAGGCACCCA...

Protein

Download Protein FASTA

690 aa · TkA01G022200|TK1151|PROTEIN

MACDILGLTGDDKEWLHAFKDAAVWASASQLRTLFCHLLSIGKIVLAVAGSGIASLLLPSGRTAHSRFNIPLHVSNSSMCNIKKGTHLAALLQETSIIIWDEATMTDRRCFECVDRSLRDILDRKDIPFGGISVLRGGDFRQTLPVKPKKSMAEIISATLPNSTLWPHFTLHTLRTNMRLSTSAPSTDTFASWLLEIGNGTVGFRLSEYTFAIEIPPTLLIQPSANPLQDLINFVYTSDMLHNPTVAHLSNRAINDTIQI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G022200`
TK1151 ID	TkA01G022200
OH-1004 ID	LXL04_005714
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	76.900
Protein coverage (%)	TK1151 66.812 / OH-1004 79.716 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G022200`
Location	Chr01:5688896-5693063 (-)
Description	Similar to PIF4: ATP-dependent DNA helicase PIF4 (Trypanosoma brucei brucei (strain 927/4 GUTat10.1)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005714` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000723 telomere maintenance Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006260 DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006289 nucleotide-excision repair Biological Process GO:0006310 DNA recombination Biological Process GO:0007004 telomere maintenance via telomerase Biological Process GO:0007140 male meiotic nuclear division Biological Process GO:0051276 chromosome organization Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0071932 replication fork reversal Biological Process GO:0097046 replication fork progression beyond termination site Biological Process
KEGG gene cross-reference	ath:AT5G45400 prw:PsycPRwf_1560 sce:YHR031C tbr:Tb11.01.6420 tbr:Tb11.02.4730 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.891

Rank 1 · TkA01G022200 · TK1151

Cytoplasm0.182

Rank 2 · TkA01G022200 · TK1151

Mitochondrion0.024

Rank 3 · TkA01G022200 · TK1151

Extracellular0.020

Rank 4 · TkA01G022200 · TK1151

Cell membrane0.018

Rank 5 · TkA01G022200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05970PIF131-202 aa

PF28429DUF8391110-117 aa

PF28429DUF8391332-365 aa

PF28429DUF8391427-480 aa

PF08646Rep_fac-A_C468-588 aa

PF16099RMI1_C511-570 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G022200	`PF05970`	PIF1	31	202	3.6e-58	197.5
TkA01G022200	`PF28429`	DUF8391	110	117	0.072	14.0
TkA01G022200	`PF28429`	DUF8391	332	365	0.072	14.0
TkA01G022200	`PF28429`	DUF8391	427	480	0.072	14.0
TkA01G022200	`PF08646`	Rep_fac-A_C	468	588	7.6e-09	36.2
TkA01G022200	`PF16099`	RMI1_C	511	570	0.052	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card