RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G020460
Reference: TK1151 Chr: Chr01 Coordinates: 5265547-5269257 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2456 bp · TkA01G020460|TK1151|cDNA

TAAGACTACGGTTTCCTCGCTTTAAAATTTGGGGATTAGGGTTTTATAAATACAAGTTGTAGCCTACGAACATTGATTCCTCCGATTCCTGCTAACGAACAATCCAAAAATCCGCTTGTTTAATTCTCGTAAGATGGATTGATTCCAGGGTTCTGATTTGTTTTCCTCTTGTCGCCATTGCATTGCTTGCATTCAAAGCAATTTCATCATATATGTGTTTATGCATGATTGGGGATCTGAAGATTTCGAGGCATGTCTAG...

CDS

Download CDS FASTA

1665 bp · TkA01G020460|TK1151|CDS

ATGGCTTCTGGAGTGGGTTTTTTGGTACATGAGAGTGATTTGCTTGCGAAACTGAGCCTGAATTCAACACCGGAACCAGAGCTTGAAGATGCTAATGTTTTGGAACGATGCCCTAACAATCGTTACATTCGGTATAATGAAATGCTGGGGAGAGGAGCATTCAAGACTGTATACAAAGGATTTGATGAAGTTGAAGGAATTGAAATTGCCTGGAACCAAGTAAGGCTAGATGACGCCATGCAATCTCCAGAACATCTGGA...

Protein

Download Protein FASTA

554 aa · TkA01G020460|TK1151|PROTEIN

MASGVGFLVHESDLLAKLSLNSTPEPELEDANVLERCPNNRYIRYNEMLGRGAFKTVYKGFDEVEGIEIAWNQVRLDDAMQSPEHLERVYSEVHLLRTLKHENIIKSYASWVDNEKKTINMITELFTSGSLRQYRKKHKSVDLKAIKNWARQILKGLVYLHSNDPPIIHRDLKCDNIFVNGNHGEVKIGDLGLATLMLRPTAKSLLGTPEFMAPELYEEEYNELVDIYSFGMCLLELITCEYPYSECINQAQIYRKVSTG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G020460
TK1151 IDTkA01G020460
OH-1004 IDLXL04_005729
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.200
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G020460
LocationChr01:5265547-5269257 (+)
DescriptionSimilar to WNK8: Serine/threonine-protein kinase WNK8
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g41990 Regulates flowering time by modulating the photoperiod pathway.
A WNK kinase binds and phosphorylates V-ATPase subunit C.2006 · DOI: 10.1016/j.febslet.2006.01.018
The plant WNK gene family and regulation of flowering time in Arabidopsis.2008 · DOI: 10.1111/j.1438-8677.2008.00072.x
The Arabidopsis defense component EDM2 affects the floral transition in an FLC-dependent manner.2010 · DOI: 10.1111/j.1365-313x.2010.04169.x
Co-option of EDM2 to distinct regulatory modules in Arabidopsis thaliana development.2010 · DOI: 10.1186/1471-2229-10-203
At1g64630 May regulate flowering time by modulating the photoperiod pathway. No verified direct reference in this release
At1g49160 May regulate flowering time by modulating the photoperiod pathway. No verified direct reference in this release
At3g18750 May regulate flowering time by modulating the photoperiod pathway. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os02g0672800 Probable serine/threonine-protein kinase WNK4. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_005729 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0009909 regulation of flower development Biological Process
GO:0009911 positive regulation of flower development Biological Process
GO:0010228 vegetative to reproductive phase transition of meristem Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0048573 photoperiodism, flowering Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference
ath:AT1G49160
ath:AT1G64630
ath:AT3G18750
ath:AT5G41990
dosa:Os02g0672800
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.539
Rank 1 · TkA01G020460 · TK1151
Nucleus0.388
Rank 2 · TkA01G020460 · TK1151
Cell membrane0.171
Rank 3 · TkA01G020460 · TK1151
Golgi apparatus0.064
Rank 4 · TkA01G020460 · TK1151
Lysosome / Vacuole0.062
Rank 5 · TkA01G020460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr44-284 aa
PF00069Pkinase46-300 aa
PF23833DUF7203114-145 aa
PF00069Pkinase351-374 aa
PF12202OSR1_C369-426 aa
PF04889Cwf_Cwc_15482-524 aa
PF10986ZrgA491-529 aa
PF23833DUF7203509-551 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G020460PF07714PK_Tyr_Ser-Thr442849.9e-37127.4
TkA01G020460PF00069Pkinase463003.8e-51174.7
TkA01G020460PF23833DUF72031141450.1113.5
TkA01G020460PF00069Pkinase3513743.8e-51174.7
TkA01G020460PF12202OSR1_C3694260.0006420.5
TkA01G020460PF04889Cwf_Cwc_154825240.1212.9
TkA01G020460PF10986ZrgA4915290.4211.3
TkA01G020460PF23833DUF72035095510.1113.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q944Q0Arabidopsis thalianasp|Q944Q0|WNK8_ARATH Serine/threonine-protein kinase WNK850.000%Swiss-ProtHigh
Q8RXE5Arabidopsis thalianasp|Q8RXE5|WNK10_ARATH Probable serine/threonine-protein kinase WNK1049.800%Swiss-ProtMedium
Q8LST2Arabidopsis thalianasp|Q8LST2|WNK7_ARATH Probable serine/threonine-protein kinase WNK756.700%Swiss-ProtHigh
Q8S8Y8Arabidopsis thalianasp|Q8S8Y8|WNK6_ARATH Probable serine/threonine-protein kinase WNK656.500%Swiss-ProtHigh
Q6EU49Oryza sativa subsp. japonicasp|Q6EU49|WNK4_ORYSJ Probable serine/threonine-protein kinase WNK455.900%Swiss-ProtHigh

JBrowse

View in Genome Browser