RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G019180
Reference: TK1151 Chr: Chr01 Coordinates: 4909436-4911837 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2216 bp · TkA01G019180|TK1151|cDNA

GGTAAGGATCCATACAATTGGAAAAAGGTTTCCTCCTTCAGAAACACCTTCAATTTCATAAATTCCCCATTGTTTCTCTAATCCTCTCAGTTTTCCTCGATTTCCACCAATTGAATCTACATCAATCTCCCATTTTCAAGATTCAAAACACATATATCGAGCTACTGGAAGAGCCCTTTGATTTGAGGTTATCCATTTGGGGTCTTTCTAATCAAAAGAGCATTAGGATTTTGCTCTTTTGTGTTTCTGAATATAGAAAT...

CDS

Download CDS FASTA

1644 bp · TkA01G019180|TK1151|CDS

ATGTCAGTTGCTGACGTTGCTTTGAGTCCAATTCACAAAAGGCCCGGCTCCGTTTGTTCACGGAGCAGTGAATCCATCGTGATTTACTTAACAATTGCAGGTTCCGTGATTCCAATGAGAATTATGGAATCCGATTCCATTGCCACCGTGAAACTAAGGATTCAGACGTGTAAAGGATTTGTAGTGAAGAAACAAAAGCTTGTTTTCGAAGGGAGAGAATTATCAAGAAATAATTCTCTTTTGAAAGACTATGGTGTTTC...

Protein

Download Protein FASTA

547 aa · TkA01G019180|TK1151|PROTEIN

MSVADVALSPIHKRPGSVCSRSSESIVIYLTIAGSVIPMRIMESDSIATVKLRIQTCKGFVVKKQKLVFEGRELSRNNSLLKDYGVSSGDVLHLILRVSDLLMITVDTAIGKAFEFEVDRFRNVKYLKELVEEKAKGIGFVNGEDLKILCNGEKLDDERLIDDICKNHDAVIHLVVQKSSPYERNPKKDERKTNPKKPPDIDFPLQPIVVNPDSKLSPDISNMLDSASEGLQKGKKPIISSEGTGGTYFMQHPSGNKYVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G019180
TK1151 IDTkA01G019180
OH-1004 IDLXL04_005748
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G019180
LocationChr01:4909436-4911837 (-)
DescriptionSimilar to PI4KG2: Phosphatidylinositol 4-kinase gamma 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
UniProt: Q9SGW8 The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). No verified direct reference in this release
At2g46500 The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3) (By similarity).
Characterization of a new family of protein kinases from Arabidopsis containing phosphoinositide 3/4-kinase and ubiquitin-like domains.2008 · DOI: 10.1042/bj20070959
At5g24240 The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). No verified direct reference in this release
At3g56600 The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os02g0290500 The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3) (By similarity). No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_005748 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009908 flower development Biological Process
GO:0009909 regulation of flower development Biological Process
GO:0034051 negative regulation of plant-type hypersensitive response Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process
GO:0048364 root development Biological Process
GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process
GO:0050821 protein stabilization Biological Process
GO:0071456 cellular response to hypoxia Biological Process
GO:1902074 response to salt Biological Process
KEGG gene cross-reference
ath:AT1G13640
ath:AT2G46500
ath:AT5G24240
dosa:Os02g0290500
osa:4329058
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.400
Rank 1 · TkA01G019180 · TK1151
Nucleus0.287
Rank 2 · TkA01G019180 · TK1151
Cell membrane0.230
Rank 3 · TkA01G019180 · TK1151
Endoplasmic reticulum0.129
Rank 4 · TkA01G019180 · TK1151
Golgi apparatus0.108
Rank 5 · TkA01G019180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00240ubiquitin33-98 aa
PF11976Rad60-SLD35-96 aa
PF18036Ubiquitin_460-98 aa
PF13881Rad60-SLD_262-96 aa
PF18036Ubiquitin_4102-135 aa
PF00240ubiquitin104-178 aa
PF11976Rad60-SLD104-176 aa
PF13881Rad60-SLD_2139-192 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G019180PF00240ubiquitin33982e-2279.5
TkA01G019180PF11976Rad60-SLD35962.2e-0731.3
TkA01G019180PF18036Ubiquitin_460980.006117.2
TkA01G019180PF13881Rad60-SLD_262960.01116.6
TkA01G019180PF18036Ubiquitin_41021350.006117.2
TkA01G019180PF00240ubiquitin1041782e-2279.5
TkA01G019180PF11976Rad60-SLD1041762.2e-0731.3
TkA01G019180PF13881Rad60-SLD_21391920.01116.6
TkA01G019180PF18036Ubiquitin_41631790.006117.2
TkA01G019180PF00454PI3_PI4_kinase2444912.3e-48165.9
TkA01G019180PF03109ABC12502720.02514.5
TkA01G019180PF20613HipA_23704220.08712.8
TkA01G019180PF03109ABC13814150.02514.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SGW8Arabidopsis thalianasp|Q9SGW8|P4KG2_ARATH Phosphatidylinositol 4-kinase gamma 257.700%Swiss-ProtHigh
Q9ZPY9Arabidopsis thalianasp|Q9ZPY9|P4KG4_ARATH Phosphatidylinositol 4-kinase gamma 456.000%Swiss-ProtHigh
Q9FNF8Arabidopsis thalianasp|Q9FNF8|P4KG3_ARATH Phosphatidylinositol 4-kinase gamma 354.500%Swiss-ProtHigh
Q0WMZ6Arabidopsis thalianasp|Q0WMZ6|P4KG8_ARATH Phosphatidylinositol 4-kinase gamma 835.800%Swiss-ProtMedium
Q6K881Oryza sativa subsp. japonicasp|Q6K881|P4KG4_ORYSJ Phosphatidylinositol 4-kinase gamma 453.800%Swiss-ProtHigh

JBrowse

View in Genome Browser