TkA01G018360 | RubberDandelionOmics

Gene overview

TkA01G018360

Reference: TK1151 Chr: Chr01 Coordinates: 4666074-4669981 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2184 bp · TkA01G018360|TK1151|cDNA

ATGGAGGCTTTTCTCAAGAAGTCTCAACATGATCTTAAAGTCTTTAGCTTTGAAGAGATAAAGTTGATCACTGGCGACTTTGATAAGAACAATCTTATTGGAGAAGGTGGATTCGGGAAAGTGTACAGAGGAGTTGTCGACTTCGACTCTAAGGGGCAAACCATGGCTGCTTTTAAGCGTCTCGATAGAAGTTGTGGGCAAGGAAATCCTGAGTTCATGAAAGAGATCTTGATGCTTTCCCATTACAGACATGAAAATCT...

CDS

Download CDS FASTA

2184 bp · TkA01G018360|TK1151|CDS

ATGGAGGCTTTTCTCAAGAAGTCTCAACATGATCTTAAAGTCTTTAGCTTTGAAGAGATAAAGTTGATCACTGGCGACTTTGATAAGAACAATCTTATTGGAGAAGGTGGATTCGGGAAAGTGTACAGAGGAGTTGTCGACTTCGACTCTAAGGGGCAAACCATGGCTGCTTTTAAGCGTCTCGATAGAAGTTGTGGGCAAGGAAATCCTGAGTTCATGAAAGAGATCTTGATGCTTTCCCATTACAGACATGAAAATCT...

Protein

Download Protein FASTA

727 aa · TkA01G018360|TK1151|PROTEIN

MEAFLKKSQHDLKVFSFEEIKLITGDFDKNNLIGEGGFGKVYRGVVDFDSKGQTMAAFKRLDRSCGQGNPEFMKEILMLSHYRHENLITLLGYCDKDPEKILVYEHAARGSLDVHLSSTTLTWTQRLKICLGAARGLCYLHDPNETKQRVIHRDLKSSNILLDENWNAKISDMGLSKTGSANSLQSFLATNVVGTIFYIDPEYMETTILTKESDVYSFGVVLFEVLCGSLCYEYKNGLPQRFVRRWTNRYKENKVEDIIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G018360`
TK1151 ID	TkA01G018360
OH-1004 ID	LXL04_005760
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G018360

Location Chr01:4666074-4669981 (-)

Description Similar to At5g38990: Probable receptor-like protein kinase At5g38990

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005760 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009723 response to ethylene Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

KEGG gene cross-reference

ath:AT3G46290

ath:AT3G51550

ath:AT5G28680

ath:AT5G38990

ath:AT5G39000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.570

Rank 1 · TkA01G018360 · TK1151

Nucleus0.336

Rank 2 · TkA01G018360 · TK1151

Cell membrane0.219

Rank 3 · TkA01G018360 · TK1151

Endoplasmic reticulum0.073

Rank 4 · TkA01G018360 · TK1151

Lysosome / Vacuole0.052

Rank 5 · TkA01G018360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01636APH23-49 aa

PF00069Pkinase28-298 aa

PF07714PK_Tyr_Ser-Thr30-300 aa

PF01636APH141-166 aa

PF14874PapD-like394-427 aa

PF14299PP2413-486 aa

PF14299PP2570-726 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G018360	`PF01636`	APH	23	49	0.086	13.3
TkA01G018360	`PF00069`	Pkinase	28	298	1.6e-41	143.2
TkA01G018360	`PF07714`	PK_Tyr_Ser-Thr	30	300	2.4e-45	155.6
TkA01G018360	`PF01636`	APH	141	166	0.086	13.3
TkA01G018360	`PF14874`	PapD-like	394	427	0.25	12.2
TkA01G018360	`PF14299`	PP2	413	486	1.3e-19	71.4
TkA01G018360	`PF14299`	PP2	570	726	1.3e-19	71.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FID9`	Arabidopsis thaliana	sp\|Q9FID9\|Y5389_ARATH Probable receptor-like protein kinase At5g38990	46.100%	Swiss-Prot	Low
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	45.400%	Swiss-Prot	Low
`Q3E8W4`	Arabidopsis thaliana	sp\|Q3E8W4\|ANX2_ARATH Receptor-like protein kinase ANXUR2	46.300%	Swiss-Prot	Low
`Q9SCZ4`	Arabidopsis thaliana	sp\|Q9SCZ4\|FERON_ARATH Receptor-like protein kinase FERONIA	45.300%	Swiss-Prot	Low
`Q9SR05`	Arabidopsis thaliana	sp\|Q9SR05\|ANX1_ARATH Receptor-like protein kinase ANXUR1	45.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card