RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G016460
Reference: TK1151 Chr: Chr01 Coordinates: 4225783-4228554 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2007 bp · TkA01G016460|TK1151|cDNA

CCTACATCAACTCACCTGTCCTTTGTCTCACTCTTTACACCATTACACACCCAAGGGCAGTTTGGTAATTTTACAATCTACAACTTATTTCAGACACCATCCACATATCTCTCCCCACATGCTTTGACTCCAATCTTTGACACCGCGTAATGGGCAACTGCAACGGCGTCCCGGCTACCGCCAACGGCGGCGCCACCACCACCACCACCACCACCCACACCTCCAACTCAAACAACCCAACTACACCACAACCACAGCAA...

CDS

Download CDS FASTA

1590 bp · TkA01G016460|TK1151|CDS

ATGGGCAACTGCAACGGCGTCCCGGCTACCGCCAACGGCGGCGCCACCACCACCACCACCACCACCCACACCTCCAACTCAAACAACCCAACTACACCACAACCACAGCAACAATCTCCACCCAAGGGCCTCACGATCCTTCCCGCATCGGATCCAGCACCTCCTCGCCAACCGCCGCCGGCCAGCGTCGGCCGTGTCCTCGGCCGCCCACTGGAAGATGTTCGCGCAACCTACACAATGGGTCGAGAGCTAGGCCGCGG...

Protein

Download Protein FASTA

529 aa · TkA01G016460|TK1151|PROTEIN

MGNCNGVPATANGGATTTTTTTHTSNSNNPTTPQPQQQSPPKGLTILPASDPAPPRQPPPASVGRVLGRPLEDVRATYTMGRELGRGQFGVTYLVTHKTTHQQFACKSIAMRKLVNKDDIEDVRREVQIMHHLTGHRNIVELKGAYEDRHSVNLIMELCAGGELFDRIIAKGHYSERAAAGLCRQMVTVVHNCHTMGVFHRDLKPENFLFLNTDEDSPLKATDFGLSVFFKPGDVFKDLVGSAYYVAPEVLRRRYGAEAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G016460
TK1151 IDTkA01G016460
OH-1004 IDLXL04_005801
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G016460
LocationChr01:4225783-4228554 (+)
DescriptionSimilar to CPK1: Calcium-dependent protein kinase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g23650 May play a role in signal transduction pathways that involve calcium as a second messenger.
CDPKs CPK6 and CPK3 function in ABA regulation of guard cell S-type anion- and Ca(2+)-permeable channels and stomatal closure.2006 · DOI: 10.1371/journal.pbio.0040327
At5g12180 May play a role in signal transduction pathways that involve calcium as a second messenger. No verified direct reference in this release
At5g19360 May play a role in signal transduction pathways that involve calcium as a second messenger. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0622600 May play a role in signal transduction pathways that involve calcium as a second messenger. No verified direct reference in this release
Os05g0585500 May play a role in signal transduction pathways that involve calcium as a second messenger. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_005801 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009651 response to salt stress Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0010119 regulation of stomatal movement Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0080092 regulation of pollen tube growth Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference
ath:AT4G23650
ath:AT5G12180
ath:AT5G19360
dosa:Os05g0585500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.540
Rank 1 · TkA01G016460 · TK1151
Cytoplasm0.389
Rank 2 · TkA01G016460 · TK1151
Nucleus0.223
Rank 3 · TkA01G016460 · TK1151
Golgi apparatus0.063
Rank 4 · TkA01G016460 · TK1151
Endoplasmic reticulum0.052
Rank 5 · TkA01G016460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase78-336 aa
PF07714PK_Tyr_Ser-Thr79-331 aa
PF14531Kinase-like79-138 aa
PF06293Kdo153-215 aa
PF14531Kinase-like174-321 aa
PF06293Kdo351-373 aa
PF07714PK_Tyr_Ser-Thr360-390 aa
PF14069SpoVIF361-380 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G016460PF00069Pkinase783362.6e-76257.2
TkA01G016460PF07714PK_Tyr_Ser-Thr793312.9e-2796.3
TkA01G016460PF14531Kinase-like791386.1e-0626.4
TkA01G016460PF06293Kdo1532150.007416.5
TkA01G016460PF14531Kinase-like1743216.1e-0626.4
TkA01G016460PF06293Kdo3513730.007416.5
TkA01G016460PF07714PK_Tyr_Ser-Thr3603902.9e-2796.3
TkA01G016460PF14069SpoVIF3613800.113.0
TkA01G016460PF17802SpaA3634070.1113.4
TkA01G016460PF13833EF-hand_83644051.3e-1970.4
TkA01G016460PF20742DUF5580_M3644420.02315.5
TkA01G016460PF21008AIF-13714431.9e-0628.9
TkA01G016460PF00069Pkinase3724242.6e-76257.2
TkA01G016460PF05823Gp-FAR-13744180.008917.2
TkA01G016460PF10591SPARC_Ca_bdg3754428.6e-0730.0
TkA01G016460PF12763EH3764472.3e-0834.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q42479Arabidopsis thalianasp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 374.400%Swiss-ProtHigh
Q9FMP5Arabidopsis thalianasp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 1767.300%Swiss-ProtHigh
Q3E9C0Arabidopsis thalianasp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 3467.400%Swiss-ProtHigh
A2ZVI7Oryza sativa subsp. japonicasp|A2ZVI7|CDPK1_ORYSJ Calcium-dependent protein kinase 183.400%Swiss-ProtHigh
Q6I587Oryza sativa subsp. japonicasp|Q6I587|CDPKF_ORYSJ Calcium-dependent protein kinase 1577.300%Swiss-ProtHigh

JBrowse

View in Genome Browser