TkA01G015610 | RubberDandelionOmics

Gene overview

TkA01G015610

Reference: TK1151 Chr: Chr01 Coordinates: 4000530-4004136 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1346 bp · TkA01G015610|TK1151|cDNA

AAGCAGTACTATTTTGGTTTTTTTCTATTTAATTTGTTTTACCAACTAATGCCTTGAAACAGGACAATAACATTAAAAAGACTGTAGGATTTTGGCTATAAAGCTTAGCTCCATATCATATTGCTTAAAATTAAATACCTCATTCTCCTTCTCATGGTAGAGGCTGCAATGGAATTCCGATTCAACTTGGATTCTCACACAATTACAAATGTTGATAAGGTTTCCATTTTAAATGCTAACCCTTTATTACTGGAATCGGT...

CDS

Download CDS FASTA

603 bp · TkA01G015610|TK1151|CDS

ATGGTAGAGGCTGCAATGGAATTCCGATTCAACTTGGATTCTCACACAATTACAAATGTTGATAAGGTTTCCATTTTAAATGCTAACCCTTTATTACTGGAATCGGTGGTCTCGGAAGGTGTATGCACTGTTCACAATCAGCCGGCTAAATGTAAGCCACTAAAAGAAGCCGACAAGGCAGCATCACTTCCATGTTCTTCCGCTTCTGCGCTGTTTCTTGATCTAGAAATGGCTCATCTATACAAGAGTAGACTCCAAAA...

Protein

Download Protein FASTA

200 aa · TkA01G015610|TK1151|PROTEIN

MVEAAMEFRFNLDSHTITNVDKVSILNANPLLLESVVSEGVCTVHNQPAKCKPLKEADKAASLPCSSASALFLDLEMAHLYKSRLQNHVQKKNIAFPVYTCEMQGPSHSRLFKARVTIDGATFKGLEFCSTLKDAEHAAAKVAFMALSPDGTQEDDSLYKSLLQEHAQKKGLPLPVYPTNRTGQPHIPSFASTVEIAVTR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G015610`
TK1151 ID	TkA01G015610
OH-1004 ID	LXL04_033551
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.200
Protein coverage (%)	TK1151 60.000 / OH-1004 93.750 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G015610

Location Chr01:4000530-4004136 (-)

Description Similar to DBR4: Double-stranded RNA-binding protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41070`	Binds double-stranded RNA.	Specific interactions between Dicer-like proteins and HYL1/DRB-family dsRNA-binding proteins in Arabidopsis thaliana.2005 · DOI: 10.1007/s11103-004-6853-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0508500`	Binds double-stranded RNA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033551 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009616 RNAi-mediated antiviral immune response Biological Process

GO:0010267 ta-siRNA processing Biological Process

GO:0035196 miRNA processing Biological Process

GO:0051607 defense response to virus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003725 double-stranded RNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G28380

ath:AT3G26932

ath:AT3G62800

dosa:Os05g0150400

dosa:Os09g0508500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.627

Rank 1 · TkA01G015610 · TK1151

Cytoplasm0.450

Rank 2 · TkA01G015610 · TK1151

Cell membrane0.059

Rank 3 · TkA01G015610 · TK1151

Endoplasmic reticulum0.058

Rank 4 · TkA01G015610 · TK1151

Mitochondrion0.040

Rank 5 · TkA01G015610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14709DND1_DSRM39-62 aa

PF00035dsrm50-62 aa

PF00035dsrm81-144 aa

PF14709DND1_DSRM83-147 aa

PF14954LIX1104-145 aa

PF00035dsrm159-196 aa

PF14709DND1_DSRM160-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G015610	`PF14709`	DND1_DSRM	39	62	6.8e-08	33.4
TkA01G015610	`PF00035`	dsrm	50	62	1.5e-19	71.0
TkA01G015610	`PF00035`	dsrm	81	144	1.5e-19	71.0
TkA01G015610	`PF14709`	DND1_DSRM	83	147	6.8e-08	33.4
TkA01G015610	`PF14954`	LIX1	104	145	0.0074	16.4
TkA01G015610	`PF00035`	dsrm	159	196	1.5e-19	71.0
TkA01G015610	`PF14709`	DND1_DSRM	160	196	6.8e-08	33.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GY79`	Arabidopsis thaliana	sp\|Q8GY79\|DRB5_ARATH Double-stranded RNA-binding protein 5	42.100%	Swiss-Prot	Medium
`B7E321`	Oryza sativa subsp. japonica	sp\|B7E321\|DRB5_ORYSJ Double-stranded RNA-binding protein 5	46.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card