TkA01G013240 | RubberDandelionOmics

Gene overview

TkA01G013240

Reference: TK1151 Chr: Chr01 Coordinates: 3415440-3416828 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

884 bp · TkA01G013240|TK1151|cDNA

CTTCATATACACACTCTACACTTTCACACAAACAATCGTAAATGGATAATAGAGTGTTAGGGTTCTGTGCAATTGCAGCGGTGCTCGGAATAATATCAGCAGCCACCGCTTTTGCAGCGGAAGTGACTAAGGTTAAGGCATCTGAAGTTTATATCTTGTATGATTTGTGTGTGTATCCAAATAGTCCAGCTCTTGCACTTGGAATCGTTTCAGCCGTGTTCACGATCATTACACGAATTTACATAAGTGTTTCGTTTGGT...

CDS

Download CDS FASTA

621 bp · TkA01G013240|TK1151|CDS

ATGGATAATAGAGTGTTAGGGTTCTGTGCAATTGCAGCGGTGCTCGGAATAATATCAGCAGCCACCGCTTTTGCAGCGGAAGTGACTAAGGTTAAGGCATCTGAAGTTTATATCTTGTATGATTTGTGTGTGTATCCAAATAGTCCAGCTCTTGCACTTGGAATCGTTTCAGCCGTGTTCACGATCATTACACGAATTTACATAAGTGTTTCGTTTGGTGGAGGAGGTTGTTGTCGAAGTGACCCAAATTCGACCCCAGT...

Protein

Download Protein FASTA

206 aa · TkA01G013240|TK1151|PROTEIN

MDNRVLGFCAIAAVLGIISAATAFAAEVTKVKASEVYILYDLCVYPNSPALALGIVSAVFTIITRIYISVSFGGGGCCRSDPNSTPVSKLLFVLSWVATVVAVILLLTAAGLNNRQGGQIDAFGYITCYVVKPGIFAAGGILALLSAIFGIAAYVSLTSGTQATTNHGVALPVRTNGDLEKYPVANYPPQQFPPQQYPPQQYPVQQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G013240`
TK1151 ID	TkA01G013240
OH-1004 ID	LXL04_005846
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 90.291 / OH-1004 90.291 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G013240

Location Chr01:3415440-3416828 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19370`	Together with MWL1, contributes to secondary cell wall biology, specifically lignin biosynthesis.	The Arabidopsis Domain of Unknown Function 1218 (DUF1218) Containing Proteins, MODIFYING WALL LIGNIN-1 and 2 (At1g31720/MWL-1 and At4g19370/MWL-2) Function Redundantly to Alter Secondary Cell Wall Lignin Content.2016 · DOI: 10.1371/journal.pone.0150254

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005846 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009808 lignin metabolic process Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G31720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.701

Rank 1 · TkA01G013240 · TK1151

Cytoplasm0.141

Rank 2 · TkA01G013240 · TK1151

Endoplasmic reticulum0.103

Rank 3 · TkA01G013240 · TK1151

Lysosome / Vacuole0.098

Rank 4 · TkA01G013240 · TK1151

Golgi apparatus0.056

Rank 5 · TkA01G013240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06653Claudin_38-19 aa

PF07344Amastin10-106 aa

PF06749DUF121811-26 aa

PF06653Claudin_354-138 aa

PF06749DUF121857-147 aa

PF07344Amastin136-155 aa

PF06653Claudin_3140-162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G013240	`PF06653`	Claudin_3	8	19	3.9	8.2
TkA01G013240	`PF07344`	Amastin	10	106	0.017	15.8
TkA01G013240	`PF06749`	DUF1218	11	26	2.8e-14	54.0
TkA01G013240	`PF06653`	Claudin_3	54	138	3.9	8.2
TkA01G013240	`PF06749`	DUF1218	57	147	2.8e-14	54.0
TkA01G013240	`PF07344`	Amastin	136	155	0.017	15.8
TkA01G013240	`PF06653`	Claudin_3	140	162	3.9	8.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65708`	Arabidopsis thaliana	sp\|O65708\|MWL2_ARATH Protein MODIFYING WALL LIGNIN-2	30.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card