TkA01G013090 | RubberDandelionOmics

Gene overview

TkA01G013090

Reference: TK1151 Chr: Chr01 Coordinates: 3381736-3384333 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

892 bp · TkA01G013090|TK1151|cDNA

GTTGATATATACAGACCTCATAAATGGAGAGCAAAGCAGTAGGTTTTTGCGCAGTTGTAGCAGTGCTCGGAATAATATCAGCAGCTTGTGGTTTTGCGGGAGAGATCACTAGGGTTAAGGCTGAAGATCTTTATATTGTGGGGAATTCGTGTGTTTATCCAAGTAGTCCAGCTCTCGCCCTTGGAATCATAGCCGCCGTCTTCACAATCATAGCCCGAATTTACATCAGCGTTACATTTGGCGGATGCAGATGTTTTCAA...

CDS

Download CDS FASTA

597 bp · TkA01G013090|TK1151|CDS

ATGGAGAGCAAAGCAGTAGGTTTTTGCGCAGTTGTAGCAGTGCTCGGAATAATATCAGCAGCTTGTGGTTTTGCGGGAGAGATCACTAGGGTTAAGGCTGAAGATCTTTATATTGTGGGGAATTCGTGTGTTTATCCAAGTAGTCCAGCTCTCGCCCTTGGAATCATAGCCGCCGTCTTCACAATCATAGCCCGAATTTACATCAGCGTTACATTTGGCGGATGCAGATGTTTTCAAAATGACCCCAATTCCACCCCAAT...

Protein

Download Protein FASTA

198 aa · TkA01G013090|TK1151|PROTEIN

MESKAVGFCAVVAVLGIISAACGFAGEITRVKAEDLYIVGNSCVYPSSPALALGIIAAVFTIIARIYISVTFGGCRCFQNDPNSTPISKLLGVLSWVASVIAVILLLAAAGLNNREGGQVDSYGYFTCYVVKPGIFAAGAVLSLVSAAFGIAAYLTLTPPTQTTMVNPAIASPMGVNVDPEKGPVPFPPQHYPPQQQY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G013090`
TK1151 ID	TkA01G013090
OH-1004 ID	LXL04_005846
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	66.500
Protein coverage (%)	TK1151 93.434 / OH-1004 89.320 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G013090`
Location	Chr01:3381736-3384333 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005846` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009808 lignin metabolic process Biological Process GO:0009809 lignin biosynthetic process Biological Process GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	ath:AT1G31720 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.731

Rank 1 · TkA01G013090 · TK1151

Cytoplasm0.124

Rank 2 · TkA01G013090 · TK1151

Endoplasmic reticulum0.103

Rank 3 · TkA01G013090 · TK1151

Lysosome / Vacuole0.085

Rank 4 · TkA01G013090 · TK1151

Nucleus0.055

Rank 5 · TkA01G013090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01284MARVEL3-104 aa

PF20990DUF2207_C4-66 aa

PF17270MAP_090010-59 aa

PF06749DUF121811-23 aa

PF07344Amastin11-106 aa

PF01284MARVEL45-110 aa

PF06749DUF121857-147 aa

PF20990DUF2207_C87-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G013090	`PF01284`	MARVEL	3	104	0.12	13.1
TkA01G013090	`PF20990`	DUF2207_C	4	66	6.5	7.1
TkA01G013090	`PF17270`	MAP_0900	10	59	0.18	12.6
TkA01G013090	`PF06749`	DUF1218	11	23	2.4e-14	54.2
TkA01G013090	`PF07344`	Amastin	11	106	3.4	8.3
TkA01G013090	`PF01284`	MARVEL	45	110	0.12	13.1
TkA01G013090	`PF06749`	DUF1218	57	147	2.4e-14	54.2
TkA01G013090	`PF20990`	DUF2207_C	87	149	6.5	7.1
TkA01G013090	`PF01284`	MARVEL	91	158	0.12	13.1
TkA01G013090	`PF17270`	MAP_0900	92	113	0.18	12.6
TkA01G013090	`PF07344`	Amastin	136	155	3.4	8.3
TkA01G013090	`PF17270`	MAP_0900	141	156	0.18	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card