TkA01G007940 | RubberDandelionOmics

Gene overview

TkA01G007940

Reference: TK1151 Chr: Chr01 Coordinates: 2081859-2087483 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2869 bp · TkA01G007940|TK1151|cDNA

TTTGCAGCTATAAAAATAAGTCAAGGTGGTCAACTTAGTGTAACGAAAAAAGTGTTTATCTCAAACCGTTGAAATTTCAGACGTTTCATGGATTTGGGAATTAAAGAAAGTTTAGCCAATGCGTTGAAACAAAGCCGATATCATGCGAAAAGATGCTTTGACCGTTTTACATCACGTGGGAGACGATTAGTGAAACCCCAAGAATTGATTTATGCAATCGAAAAAACCATAGATGACGAGCTTGAAAGAACCAAGGTTTT...

CDS

Download CDS FASTA

2664 bp · TkA01G007940|TK1151|CDS

ATGGATTTGGGAATTAAAGAAAGTTTAGCCAATGCGTTGAAACAAAGCCGATATCATGCGAAAAGATGCTTTGACCGTTTTACATCACGTGGGAGACGATTAGTGAAACCCCAAGAATTGATTTATGCAATCGAAAAAACCATAGATGACGAGCTTGAAAGAACCAAGGTTTTGGAGGGTTCATTAGGTCAAATATTGAGGTCTACGGAGGAGGCTGTAGTAATTCCACCAAATGTGGTATTGGCGGTAAGAGGGAGTCC...

Protein

Download Protein FASTA

887 aa · TkA01G007940|TK1151|PROTEIN

MDLGIKESLANALKQSRYHAKRCFDRFTSRGRRLVKPQELIYAIEKTIDDELERTKVLEGSLGQILRSTEEAVVIPPNVVLAVRGSPGRWEYLKVNADDVTVHALTPTQYLTLKESIYRANDEDTLDVDFEAFDFCMPRLTLPSSIGNGFHYISKFTTSRLDGDLEKAKPLLDHLLTLNHCGEKLMINETLDSISKLQKALIVADVYLSAHQKDEPWRTFEHKLKEWGFEKGWGDSAKKVKETMKMLSEILQAPDPSNME...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G007940`
TK1151 ID	TkA01G007940
OH-1004 ID	LXL04_005905
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G007940

Location Chr01:2081859-2087483 (-)

Description Similar to SUS6: Sucrose synthase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73370`	Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.	Normal growth of Arabidopsis requires cytosolic invertase but not sucrose synthase.2009 · DOI: 10.1073/pnas.0900689106
`At5g37180`	Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.	Normal growth of Arabidopsis requires cytosolic invertase but not sucrose synthase.2009 · DOI: 10.1073/pnas.0900689106

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0249500`	Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.	No verified direct reference in this release
`Os04g0309600`	Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.	No verified direct reference in this release
`Os02g0831500`	Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005905 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005985 sucrose metabolic process Biological Process

GO:0080165 callose deposition in phloem sieve plate Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0016157 sucrose synthase activity Molecular Function

KEGG gene cross-reference

ath:AT1G73370

dosa:Os02g0831500

dosa:Os04g0249500

dosa:Os04g0309600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.347

Rank 1 · TkA01G007940 · TK1151

Mitochondrion0.241

Rank 2 · TkA01G007940 · TK1151

Nucleus0.176

Rank 3 · TkA01G007940 · TK1151

Endoplasmic reticulum0.174

Rank 4 · TkA01G007940 · TK1151

Cell membrane0.102

Rank 5 · TkA01G007940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24861SUS_N5-115 aa

PF24862SUS_EPBD148-235 aa

PF00862GT-B_Sucrose_synth258-546 aa

PF00534Glycos_transf_1558-721 aa

PF13692Glyco_trans_1_4565-719 aa

PF20706GT4-conflict660-702 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G007940	`PF24861`	SUS_N	5	115	3.1e-39	134.4
TkA01G007940	`PF24862`	SUS_EPBD	148	235	1.9e-27	96.2
TkA01G007940	`PF00862`	GT-B_Sucrose_synth	258	546	2.9e-166	552.2
TkA01G007940	`PF00534`	Glycos_transf_1	558	721	8.7e-30	104.2
TkA01G007940	`PF13692`	Glyco_trans_1_4	565	719	2.6e-12	47.9
TkA01G007940	`PF20706`	GT4-conflict	660	702	0.00055	19.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FX32`	Arabidopsis thaliana	sp\|Q9FX32\|SUS6_ARATH Sucrose synthase 6	70.100%	Swiss-Prot	High
`F4K5W8`	Arabidopsis thaliana	sp\|F4K5W8\|SUS5_ARATH Sucrose synthase 5	66.000%	Swiss-Prot	High
`Q7XNX6`	Oryza sativa subsp. japonica	sp\|Q7XNX6\|SUS7_ORYSJ Sucrose synthase 7	67.100%	Swiss-Prot	High
`H6TFZ4`	Oryza sativa subsp. japonica	sp\|H6TFZ4\|SUS5_ORYSJ Sucrose synthase 5	66.900%	Swiss-Prot	High
`Q6K973`	Oryza sativa subsp. japonica	sp\|Q6K973\|SUS6_ORYSJ Sucrose synthase 6	65.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card