TkA01G006700 | RubberDandelionOmics

Gene overview

TkA01G006700

Reference: TK1151 Chr: Chr01 Coordinates: 1740203-1743207 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1645 bp · TkA01G006700|TK1151|cDNA

CTAGACCCAACCCTAAATCGAATATCAAATAGGTTAGGGCGACGTCGTCTTCGCCGACTACCAGTCTACCACCAGCCGACGTATTCCGCGTTTAAAACCTTTTTTCCTCCCATAGTATCCCCTCCATCCTCCTCTCCATCTCTCTAGAAAAAATGTCAGGGCTTTCATGCAACGCCTGCAACACCGAATTTCAAGATGAAAACGATCAGAAGCTCCATTACAAGTCCGAATGGCACCGCTACAATCTCAAACGCAAGGAG...

CDS

Download CDS FASTA

1125 bp · TkA01G006700|TK1151|CDS

ATGGCACCGCTACAATCTCAAACGCAAGGAGTTCCAGGAGTAACAGAAGCTCTCTTCCAAGCCAGACAGTCCACACTCGCTGAAGAGAAAAGCAGACTAAACAGCCCAGCTATGATGTACACCTGTCGCCTATGTGGCAAAGGGTACAGAAGTGCTAAAGCTCATGCTCAGCATCTAAACTCCCGGGCCCACACAACTCGAGCTTCTCAAGACCCACAACAAGACGAAAACAACGCAATAATAAAACCAATTCCATCTCG...

Protein

Download Protein FASTA

374 aa · TkA01G006700|TK1151|PROTEIN

MAPLQSQTQGVPGVTEALFQARQSTLAEEKSRLNSPAMMYTCRLCGKGYRSAKAHAQHLNSRAHTTRASQDPQQDENNAIIKPIPSRILKKPLKQQQESDDESEDSEWEEVSQNGDMASPSAIMEEEDDDNDDEDDDGMDDAEVDPTCCFMCDKEHKSIETCMVHMHKHHGFFVPDIEYLKDPTGLLTYLGLKVTRDFICLYCNSNCQPFNSLEAVRKHMVAKSHCKVHYGDDDEEEEAELEEFYDYTSSYVDVNGKELV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G006700`
TK1151 ID	TkA01G006700
OH-1004 ID	LXL04_025877
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.500
Protein coverage (%)	TK1151 97.594 / OH-1004 90.080 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G006700

Location Chr01:1740203-1743207 (+)

Description Similar to REIL1: Cytoplasmic 60S subunit biogenesis factor REI1 homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31420`	Pre-60S-associated factor involved in the cytoplasmic maturation of the 60S subunit.	The REIL1 and REIL2 proteins of Arabidopsis thaliana are required for leaf growth in the cold.2013 · DOI: 10.1104/pp.113.223925
`At2g24500`	Pre-60S-associated factor involved in the cytoplasmic maturation of the 60S subunit.	The REIL1 and REIL2 proteins of Arabidopsis thaliana are required for leaf growth in the cold.2013 · DOI: 10.1104/pp.113.223925

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025877 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0009631 cold acclimation Biological Process

GO:0042273 ribosomal large subunit biogenesis Biological Process

GO:0046330 positive regulation of JNK cascade Biological Process

GO:0090070 positive regulation of ribosome biogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G24500

ath:AT4G31420

mmu:52521

sce:YLR387C

spo:2539563

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.817

Rank 1 · TkA01G006700 · TK1151

Cytoplasm0.294

Rank 2 · TkA01G006700 · TK1151

Mitochondrion0.029

Rank 3 · TkA01G006700 · TK1151

Cell membrane0.023

Rank 4 · TkA01G006700 · TK1151

Endoplasmic reticulum0.017

Rank 5 · TkA01G006700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02945Endonuclease_727-58 aa

PF17003Actin_micro37-76 aa

PF12756zf-C2H2_240-74 aa

PF12874zf-met40-64 aa

PF12171zf-C2H2_jaz40-64 aa

PF23320Zn_SUZ1240-61 aa

PF13894zf-C2H2_440-61 aa

PF25095C2H2-zf_KIN1742-65 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G006700	`PF02945`	Endonuclease_7	27	58	0.87	10.2
TkA01G006700	`PF17003`	Actin_micro	37	76	0.18	11.8
TkA01G006700	`PF12756`	zf-C2H2_2	40	74	6.4e-30	104.1
TkA01G006700	`PF12874`	zf-met	40	64	0.0005	21.0
TkA01G006700	`PF12171`	zf-C2H2_jaz	40	64	0.0021	18.9
TkA01G006700	`PF23320`	Zn_SUZ12	40	61	0.034	14.6
TkA01G006700	`PF13894`	zf-C2H2_4	40	61	0.27	12.8
TkA01G006700	`PF25095`	C2H2-zf_KIN17	42	65	0.095	13.7
TkA01G006700	`PF09184`	PPP4R2	59	141	4.5	7.4
TkA01G006700	`PF04931`	DNA_pol_phi	91	146	4.3	6.1
TkA01G006700	`PF23320`	Zn_SUZ12	147	173	0.034	14.6
TkA01G006700	`PF14420`	Clr5	147	174	0.056	14.3
TkA01G006700	`PF02945`	Endonuclease_7	147	206	0.87	10.2
TkA01G006700	`PF12874`	zf-met	148	158	0.0005	21.0
TkA01G006700	`PF17003`	Actin_micro	148	172	0.18	11.8
TkA01G006700	`PF13894`	zf-C2H2_4	148	170	0.27	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1G5`	Arabidopsis thaliana	sp\|Q8H1G5\|REIL1_ARATH Cytoplasmic 60S subunit biogenesis factor REI1 homolog 1	57.700%	Swiss-Prot	High
`Q9ZQ18`	Arabidopsis thaliana	sp\|Q9ZQ18\|REIL2_ARATH Cytoplasmic 60S subunit biogenesis factor REI1 homolog 2	54.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card