TkA01G005150 | RubberDandelionOmics

Gene overview

TkA01G005150

Reference: TK1151 Chr: Chr01 Coordinates: 1310178-1311964 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

956 bp · TkA01G005150|TK1151|cDNA

ATAGAAAGTTGCCACCTTATTGCGGGAGCGCGGGTTCAAATCTCAACCGTGGCAATTTTGGAGGACAAATGACGGTATGAGCAAACCAAGGCCATATACTGTATATATACATGCATCCATGTGAATTCGAACTGCACACACTCCAACTCTGAAACCAAAGCTAGAGAAATCACTGAAACTGCAGAGATATGGAAACGGAATACAAAGATGTGGAGGTGGTGAATAGGAAGTCAAGCTTCAAGGGCAAGAAATTGATCTTG...

CDS

Download CDS FASTA

558 bp · TkA01G005150|TK1151|CDS

ATGGAAACGGAATACAAAGATGTGGAGGTGGTGAATAGGAAGTCAAGCTTCAAGGGCAAGAAATTGATCTTGAGGTTCTTAGCACTCACACTCACTCTCATCGCGGCCGTTGTTCTTGGAGTCGATAAGGAGACCAAAACCGTCGGTCTCACCCTTGTTACGACGCTGCCGCCGGTCCCCGTCCCTGTCACGGCCAAGTGGAAATACCTCTCTGCATTTGTGTACTTTGTGGTTGCGAACGCAATATCATGCGTCTATGC...

Protein

Download Protein FASTA

185 aa · TkA01G005150|TK1151|PROTEIN

METEYKDVEVVNRKSSFKGKKLILRFLALTLTLIAAVVLGVDKETKTVGLTLVTTLPPVPVPVTAKWKYLSAFVYFVVANAISCVYAAMSLILILTSRNASKLVSMTIFILDLAMVALLFSAIGATGSVGLIGYQGNSHVQWDKVCNVFDKFCHQVAIAAFMSFAGSITFLLLIVFTALSLHKKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G005150`
TK1151 ID	TkA01G005150
OH-1004 ID	LXL04_005949
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G005150`
Location	Chr01:1310178-1311964 (+)
Description	Similar to VIT_05s0020g01820: CASP-like protein 1E2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005949` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005886 plasma membrane Cellular Component GO:0009506 plasmodesma Cellular Component GO:0043424 protein histidine kinase binding Molecular Function
KEGG gene cross-reference	ath:AT4G15630 gmx:100500041 gmx:100793096 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.860

Rank 1 · TkA01G005150 · TK1151

Endoplasmic reticulum0.076

Rank 2 · TkA01G005150 · TK1151

Cytoplasm0.062

Rank 3 · TkA01G005150 · TK1151

Lysosome / Vacuole0.036

Rank 4 · TkA01G005150 · TK1151

Nucleus0.026

Rank 5 · TkA01G005150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04535CASP_dom17-168 aa

PF09843DUF207048-175 aa

PF06706CTV_P672-102 aa

PF06706CTV_P6155-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G005150	`PF04535`	CASP_dom	17	168	1.4e-39	136.0
TkA01G005150	`PF09843`	DUF2070	48	175	6.0	5.7
TkA01G005150	`PF06706`	CTV_P6	72	102	1.2	9.6
TkA01G005150	`PF06706`	CTV_P6	155	172	1.2	9.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card