TkA01G002300 | RubberDandelionOmics

Gene overview

TkA01G002300

Reference: TK1151 Chr: Chr01 Coordinates: 613283-616333 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2550 bp · TkA01G002300|TK1151|cDNA

ATAAAGAGAGTTGTACATATGCGTGCCGTTGAAGATAAAAGGCTGGAAAGGCCGAAATATGGTCTCGTTATTCCCGTTGGCCCAAATTAAACTTGGATTACGGCCGATCTCATCCTCCTCCGGTTTCCCTCGACTGCCTCTGCGATTCTGCACAGCAAGAAGCAGCACCTGCTCCTCCCAAACATCAGCCATGGCTGCTACCGATACGAAAATTCCGCAGCCTCCTATGGCTAAGAAGGTGAAGCACGAAATGGAAATGT...

CDS

Download CDS FASTA

2265 bp · TkA01G002300|TK1151|CDS

ATGGTCTCGTTATTCCCGTTGGCCCAAATTAAACTTGGATTACGGCCGATCTCATCCTCCTCCGGTTTCCCTCGACTGCCTCTGCGATTCTGCACAGCAAGAAGCAGCACCTGCTCCTCCCAAACATCAGCCATGGCTGCTACCGATACGAAAATTCCGCAGCCTCCTATGGCTAAGAAGGTGAAGCACGAAATGGAAATGTTTGGAGACGTTAGGGTTGACAATTACTACTGGCTCCGTGACGATTCTCGTTCCAATCC...

Protein

Download Protein FASTA

754 aa · TkA01G002300|TK1151|PROTEIN

MVSLFPLAQIKLGLRPISSSSGFPRLPLRFCTARSSTCSSQTSAMAATDTKIPQPPMAKKVKHEMEMFGDVRVDNYYWLRDDSRSNPEIIFHLQQENAYTDFIMSGTKHLEDQIYTELRSRIKEADISAPVRKGPYYYYERTLEGKEYVQHCRRLVQNGETVPSVHDTMATGPEAPPEHVILDENVKALEHGYYSIGAFKVSPNHKLVAYAEDTKGDEIYTIHVMDAETCTPVGEPLVSVTSYIEWAGDEALMYITMDAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G002300`
TK1151 ID	TkA01G002300
OH-1004 ID	LXL04_005997
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G002300`
Location	Chr01:613283-616333 (-)
Description	Similar to ptrB: Protease 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005997` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0051603 proteolysis involved in protein catabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0004177 aminopeptidase activity Molecular Function GO:0004252 serine-type endopeptidase activity Molecular Function GO:0008239 dipeptidyl-peptidase activity Molecular Function GO:0070012 oligopeptidase activity Molecular Function
KEGG gene cross-reference	ecj:JW1834 eco:b1845 ecoc:C3026_10510 rhi:NGR_a01580 rhi:NGR_a01920 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.567

Rank 1 · TkA01G002300 · TK1151

Plastid0.197

Rank 2 · TkA01G002300 · TK1151

Nucleus0.161

Rank 3 · TkA01G002300 · TK1151

Mitochondrion0.143

Rank 4 · TkA01G002300 · TK1151

Peroxisome0.109

Rank 5 · TkA01G002300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02897Peptidase_S9_N55-475 aa

PF00326Peptidase_S9536-752 aa

PF02129Peptidase_S15540-638 aa

PF12146Hydrolase_4545-645 aa

PF00756Esterase568-711 aa

PF07859Abhydrolase_3580-709 aa

PF02129Peptidase_S15663-715 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G002300	`PF02897`	Peptidase_S9_N	55	475	4e-110	369.2
TkA01G002300	`PF00326`	Peptidase_S9	536	752	4.4e-66	223.1
TkA01G002300	`PF02129`	Peptidase_S15	540	638	0.0072	16.8
TkA01G002300	`PF12146`	Hydrolase_4	545	645	0.056	13.5
TkA01G002300	`PF00756`	Esterase	568	711	0.1	13.1
TkA01G002300	`PF07859`	Abhydrolase_3	580	709	0.18	12.3
TkA01G002300	`PF02129`	Peptidase_S15	663	715	0.0072	16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card