TkA01G001830 | RubberDandelionOmics

Gene overview

TkA01G001830

Reference: TK1151 Chr: Chr01 Coordinates: 481125-485807 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2734 bp · TkA01G001830|TK1151|cDNA

GTTTGGGTACAAATCAGCTCCCAACCACTTGTCTTCAAACCTCCGACTTTCCTGCACCAAAAAAAACATCGGCCGCTTTAATCAAAAATTGGCTGAACAAAAAAATCCTTTCTCCTTTCTTCTTCTCCATCGTGATCTCTTCTGTCTCCACCATCGCCCCTGCTGCTCGCCGGCGTTTAAGCCCCTTGCCGGCGCCTCCTCCTATCATCGGCGATTCAGTCCAAGCCGGCGCCTCCTCCTCTGGTCGGCGATTCAGTCCA...

CDS

Download CDS FASTA

1665 bp · TkA01G001830|TK1151|CDS

ATGGGGGATTCAAAAGCCTGGAGGTATAGTGGAGGGGTGTTGGTTCGTAAGAAGCAGAAGCATTGCTGCTGGTTATGGCGGCCGGCGGATATGGGGAAAGGGCAGAGGCGGCGGATCTCGTGGCCCGTGGTGTGTGGGGTCATGTTGTTCACCTTAGGTCTTATATCTTTGTTTACGGGTCATGTGGCTTCGAATCTGGAGTGGTACTCTCAGAAACTTGTTAAGCATCGCTTGTGGTACAGTAAAGTGGGTCACGGACC...

Protein

Download Protein FASTA

554 aa · TkA01G001830|TK1151|PROTEIN

MGDSKAWRYSGGVLVRKKQKHCCWLWRPADMGKGQRRRISWPVVCGVMLFTLGLISLFTGHVASNLEWYSQKLVKHRLWYSKVGHGPIDIWKSELSDLYYGCSERGPHYAPAPVGELVSNGYLLIAASGGLNQQRTGITDAVVVARILNATLVVPELDHHSFWKDDSDFGNIFDVDWFISYLAKDVGVVKRVPDKYMRSLEKPPYTMRVPRHSDPQYYLDEVLPVLLRRHVVQLTKFDYRLASELNEELQRLRCRVNYHA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G001830`
TK1151 ID	TkA01G001830
OH-1004 ID	LXL04_006009
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 94.224 / OH-1004 93.874 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G001830

Location Chr01:481125-485807 (+)

Description Similar to OFUT29: O-fucosyltransferase 29

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16650`	O-fucosyltransferase 29.	No verified direct reference in this release
`At1g76270`	O-fucosyltransferase 16.	No verified direct reference in this release
`At4g38390`	Protein ROOT HAIR SPECIFIC 17.	No verified direct reference in this release
`At1g20550`	O-fucosyltransferase 6.	No verified direct reference in this release
`At1g14970`	O-fucosyltransferase 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006009 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0016020 membrane Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G14970

ath:AT1G20550

ath:AT1G76270

ath:AT4G16650

ath:AT4G38390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.833

Rank 1 · TkA01G001830 · TK1151

Endoplasmic reticulum0.066

Rank 2 · TkA01G001830 · TK1151

Cell membrane0.064

Rank 3 · TkA01G001830 · TK1151

Cytoplasm0.043

Rank 4 · TkA01G001830 · TK1151

Extracellular0.040

Rank 5 · TkA01G001830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10250O-FucT122-440 aa

PF17054JUPITER470-549 aa

PF15761IMUP521-550 aa

PF10500SR-25522-546 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G001830	`PF10250`	O-FucT	122	440	9.5e-104	348.4
TkA01G001830	`PF17054`	JUPITER	470	549	0.17	12.1
TkA01G001830	`PF15761`	IMUP	521	550	3.5	9.2
TkA01G001830	`PF10500`	SR-25	522	546	0.29	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPF8`	Arabidopsis thaliana	sp\|Q8LPF8\|OFT29_ARATH O-fucosyltransferase 29	70.900%	Swiss-Prot	High
`Q949U4`	Arabidopsis thaliana	sp\|Q949U4\|OFT16_ARATH O-fucosyltransferase 16	61.200%	Swiss-Prot	High
`Q9SVE6`	Arabidopsis thaliana	sp\|Q9SVE6\|RHS17_ARATH Protein ROOT HAIR SPECIFIC 17	62.000%	Swiss-Prot	High
`F4HSU3`	Arabidopsis thaliana	sp\|F4HSU3\|OFUT6_ARATH O-fucosyltransferase 6	59.300%	Swiss-Prot	High
`F4HXW9`	Arabidopsis thaliana	sp\|F4HXW9\|OFUT4_ARATH O-fucosyltransferase 4	44.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card