LXL04_039887 | RubberDandelionOmics

Gene overview

LXL04_039887

Reference: OH-1004 Chr: JAJTUU010000061.1 Coordinates: 69746-70864 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

603 bp · LXL04_039887|LXL04_039887|OH1004|cDNA

ATGCAGTATCAACCAGATGACAAAATCACCCTTTGGGTGAATAAAGTTGGGCCTTACAATAATCCACAAGAAACATACAATTTCTACAGTCTTCCATTTTGTCACCTACCTGGACATGCTGCACACAAGTGGGGTGGTCTTGGTGAAGTATTGGGTGGAAATGAGCTTATTGATAGCCAAATGGATGTCAAATTCCAAAAGAATGTGGAAAAGACCTCTGTCTGCAAGCTAGAACTTGATGAACCAAAAGTGATGCAGTT...

CDS

Download CDS FASTA

603 bp · LXL04_039887|LXL04_039887|OH1004|CDS

ATGCAGTATCAACCAGATGACAAAATCACCCTTTGGGTGAATAAAGTTGGGCCTTACAATAATCCACAAGAAACATACAATTTCTACAGTCTTCCATTTTGTCACCTACCTGGACATGCTGCACACAAGTGGGGTGGTCTTGGTGAAGTATTGGGTGGAAATGAGCTTATTGATAGCCAAATGGATGTCAAATTCCAAAAGAATGTGGAAAAGACCTCTGTCTGCAAGCTAGAACTTGATGAACCAAAAGTGATGCAGTT...

Protein

Download Protein FASTA

200 aa · LXL04_039887|LXL04_039887|OH1004|PROTEIN

MQYQPDDKITLWVNKVGPYNNPQETYNFYSLPFCHLPGHAAHKWGGLGEVLGGNELIDSQMDVKFQKNVEKTSVCKLELDEPKVMQFKQAIENNYWFELFMDDLPLWGFVGELHDRNTDNKHMLFTHMNITLQYNKDQVSKPNEFHDFAEYFVLKAIAHVVALVRAADRKSPREAVDFILQLLKVNVSSTIHFHSIYITT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039887`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039887

Location JAJTUU010000061.1:69746-70864 (-)

Description Similar to TMN1: Transmembrane 9 superfamily member 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10950`	Transmembrane 9 superfamily member 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039887 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006914 autophagy Biological Process

GO:0072657 protein localization to membrane Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000421 autophagosome membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005765 lysosomal membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005801 cis-Golgi network Cellular Component

GO:0005802 trans-Golgi network Cellular Component

KEGG gene cross-reference

ath:AT1G10950

hsa:10548

mmu:74140

pon:100173093

rno:361043

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.637

Rank 1 · LXL04_039887 · OH-1004

Cytoplasm0.193

Rank 2 · LXL04_039887 · OH-1004

Nucleus0.115

Rank 3 · LXL04_039887 · OH-1004

Golgi apparatus0.091

Rank 4 · LXL04_039887 · OH-1004

Extracellular0.089

Rank 5 · LXL04_039887 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02990.22EMP7025-141 aa

PF25577.2TPR_TAF2_C134-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039887	`PF02990.22`	EMP70	25	141	1.4e-25	90.7
LXL04_039887	`PF25577.2`	TPR_TAF2_C	134	197	1.2e-08	34.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940G0`	Arabidopsis thaliana	Transmembrane 9 superfamily member 1	67.568%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card