LXL04_039365 | RubberDandelionOmics

Gene overview

LXL04_039365

Reference: OH-1004 Chr: JAJTUU010000010.1 Coordinates: 4572791-4580330 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

855 bp · LXL04_039365|LXL04_039365|OH1004|cDNA

ATGGCGTACCAACATTATCGATCTCCATTTGGTGACACCACTTTAACCAAGGTGTTTGTTGGTGGACTTGCTTGGGAAACACAAACTGATGAAATGCGTAGATATTTTGAACAGTTTGGTGACATTCTTGAAGCTGTTATCATCACTGATAAAATCACCGGGAAGTCTAAGGGTTAcggatttGTGACTTATCGGGACCCTGAATCAGCAAAAAGCGCTTGTGAAGACCCCAACCCCATGATAGATGGACGAAGAGCTAA...

CDS

Download CDS FASTA

855 bp · LXL04_039365|LXL04_039365|OH1004|CDS

ATGGCGTACCAACATTATCGATCTCCATTTGGTGACACCACTTTAACCAAGGTGTTTGTTGGTGGACTTGCTTGGGAAACACAAACTGATGAAATGCGTAGATATTTTGAACAGTTTGGTGACATTCTTGAAGCTGTTATCATCACTGATAAAATCACCGGGAAGTCTAAGGGTTACGGATTTGTGACTTATCGGGACCCTGAATCAGCAAAAAGCGCTTGTGAAGACCCCAACCCCATGATAGATGGACGAAGAGCTAA...

Protein

Download Protein FASTA

284 aa · LXL04_039365|LXL04_039365|OH1004|PROTEIN

MAYQHYRSPFGDTTLTKVFVGGLAWETQTDEMRRYFEQFGDILEAVIITDKITGKSKGYGFVTYRDPESAKSACEDPNPMIDGRRANCNIASLGRPRASPQGRNQGGNIAFQRTNTMGQGVSSSYSGVPPPLAPPPPPTPPSVMYPPYGYATYAPDYSYQQAMYNPALQQAYYHQMYGPTGTPYYYGYSTTQTPTPRGTFPPPGAPTLTPHQAQRIQGPSYLYYPTPSQMDPSTFPGYLTPPPPTLLLPTRHPFPSPSPS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039365`
TK1151 ID	TkA04G228170
OH-1004 ID	LXL04_039365
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039365

Location JAJTUU010000010.1:4572791-4580330 (-)

Description Similar to ARP1: Probable RNA-binding protein ARP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54770`	Probable RNA-binding protein involved in the regulation of abscisic acid (ABA) response during seed germination.	An ABA-regulated putative RNA-binding protein affects seed germination of Arabidopsis under ABA or abiotic stress conditions.2013 · DOI: 10.1016/j.jplph.2012.09.002

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039365 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006974 DNA damage response Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0043488 regulation of mRNA stability Biological Process

KEGG gene cross-reference

ath:AT3G54770

gga:768866

hsa:55544

xla:379265

xtr:448763

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.719

Rank 1 · LXL04_039365 · OH-1004

Cytoplasm0.391

Rank 2 · LXL04_039365 · OH-1004

Cell membrane0.045

Rank 3 · LXL04_039365 · OH-1004

Endoplasmic reticulum0.037

Rank 4 · LXL04_039365 · OH-1004

Lysosome / Vacuole0.017

Rank 5 · LXL04_039365 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076.29RRM_118-76 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039365	`PF00076.29`	RRM_1	18	76	1.9e-17	63.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1S3`	Arabidopsis thaliana	Probable RNA-binding protein ARP1	66.304%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card